PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G47370.1
Common NameHAT2, MQL5.23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 283aa    MW: 31727.5 Da    PI: 7.8695
Description Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G47370.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-18129183256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q   Lee F+++++++ +++  LAkkl+Lt rqV vWFqNrRa+ k
  AT5G47370.1 129 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTK 183
                  788899***********************************************98 PP

2HD-ZIP_I/II120.49.4e-39129218191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke  eLr +l
  AT5G47370.1 129 RKKLRLSKDQSAFLEETFKEHNTLNPKQKLALAKKLNLTARQVEVWFQNRRARTKLKQTEVDCEYLKRCVEKLTEENRRLQKEAMELR-TL 218
                  69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.0E-23291IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.1E-18110186IPR009057Homeodomain-like
SuperFamilySSF466891.15E-18114186IPR009057Homeodomain-like
PROSITE profilePS5007117.313125185IPR001356Homeobox domain
SMARTSM003896.9E-16127189IPR001356Homeobox domain
PfamPF000461.0E-15129183IPR001356Homeobox domain
CDDcd000862.44E-16129186No hitNo description
PROSITE patternPS000270160183IPR017970Homeobox, conserved site
PfamPF021834.1E-8185218IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-23185228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MMMGKEDLGL SLSLGFSQNH NPLQMNLNPN SSLSNNLQRL PWNQTFDPTS DLRKIDVNSF  60
PSTVNCEEDT GVSSPNSTIS STISGKRSER EGISGTGVGS GDDHDEITPD RGYSRGTSDE  120
EEDGGETSRK KLRLSKDQSA FLEETFKEHN TLNPKQKLAL AKKLNLTARQ VEVWFQNRRA  180
RTKLKQTEVD CEYLKRCVEK LTEENRRLQK EAMELRTLKL SPQFYGQMTP PTTLIMCPSC  240
ERVGGPSSSN HHHNHRPVSI NPWVACAGQV AHGLNFEALR PRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127133SRKKLRL
2177185RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.251270.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306951640.0
Genevisible248801_at0.0
Expression AtlasAT5G47370-
AtGenExpressAT5G47370-
ATTED-IIAT5G47370-
Functional Description ? help Back to Top
Source Description
TAIRhomeobox-leucine zipper genes induced by auxin, but not by other phytohormones. Plays opposite roles in the shoot and root tissues in regulating auxin-mediated morphogenesis.
UniProtProbable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269|PubMed:12492842}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G47370.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269|PubMed:12492842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G51910
IntActSearch P46601
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G47370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4284500.0AF428450.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBankAJ4311830.0AJ431183.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT2 (hat2 gene).
GenBankAY0523240.0AY052324.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
GenBankAY0619040.0AY061904.1 Arabidopsis thaliana AT5g47370/MQL5_23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199548.10.0Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein
SwissprotP466010.0HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLA0A178UFY10.0A0A178UFY1_ARATH; HAT2
STRINGAT5G47370.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15632690
Representative plantOGRP19616156
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Sawa S, et al.
    The HAT2 gene, a member of the HD-Zip gene family, isolated as an auxin inducible gene by DNA microarray screening, affects auxin response in Arabidopsis.
    Plant J., 2002. 32(6): p. 1011-22
    [PMID:12492842]
  3. Zhao Y,Dai X,Blackwell HE,Schreiber SL,Chory J
    SIR1, an upstream component in auxin signaling identified by chemical genetics.
    Science, 2003. 301(5636): p. 1107-10
    [PMID:12893885]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  7. Devlin PF,Yanovsky MJ,Kay SA
    A genomic analysis of the shade avoidance response in Arabidopsis.
    Plant Physiol., 2003. 133(4): p. 1617-29
    [PMID:14645734]
  8. Pufky J,Qiu Y,Rao MV,Hurban P,Jones AM
    The auxin-induced transcriptome for etiolated Arabidopsis seedlings using a structure/function approach.
    Funct. Integr. Genomics, 2003. 3(4): p. 135-43
    [PMID:14648238]
  9. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  10. Hilson P, et al.
    Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications.
    Genome Res., 2004. 14(10B): p. 2176-89
    [PMID:15489341]
  11. Wilmoth JC, et al.
    NPH4/ARF7 and ARF19 promote leaf expansion and auxin-induced lateral root formation.
    Plant J., 2005. 43(1): p. 118-30
    [PMID:15960621]
  12. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  13. Vergnolle C, et al.
    The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions.
    Plant Physiol., 2005. 139(3): p. 1217-33
    [PMID:16258011]
  14. Raghavan C,Ong EK,Dalling MJ,Stevenson TW
    Regulation of genes associated with auxin, ethylene and ABA pathways by 2,4-dichlorophenoxyacetic acid in Arabidopsis.
    Funct. Integr. Genomics, 2006. 6(1): p. 60-70
    [PMID:16317577]
  15. Esmon CA, et al.
    A gradient of auxin and auxin-dependent transcription precedes tropic growth responses.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(1): p. 236-41
    [PMID:16371470]
  16. Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF
    Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis.
    Plant Physiol., 2006. 141(1): p. 85-96
    [PMID:16565297]
  17. Laskowski M,Biller S,Stanley K,Kajstura T,Prusty R
    Expression profiling of auxin-treated Arabidopsis roots: toward a molecular analysis of lateral root emergence.
    Plant Cell Physiol., 2006. 47(6): p. 788-92
    [PMID:16621846]
  18. Town CD, et al.
    Comparative genomics of Brassica oleracea and Arabidopsis thaliana reveal gene loss, fragmentation, and dispersal after polyploidy.
    Plant Cell, 2006. 18(6): p. 1348-59
    [PMID:16632643]
  19. Nemhauser JL,Hong F,Chory J
    Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses.
    Cell, 2006. 126(3): p. 467-75
    [PMID:16901781]
  20. Shin R, et al.
    The Arabidopsis transcription factor MYB77 modulates auxin signal transduction.
    Plant Cell, 2007. 19(8): p. 2440-53
    [PMID:17675404]
  21. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  22. Ciarbelli AR, et al.
    The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy.
    Plant Mol. Biol., 2008. 68(4-5): p. 465-78
    [PMID:18758690]
  23. Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF
    ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings.
    Plant J., 2009. 59(2): p. 266-77
    [PMID:19392702]
  24. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  25. Bou-Torrent J, et al.
    ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis.
    Plant Signal Behav, 2012. 7(11): p. 1382-7
    [PMID:22918502]
  26. Cruz-Ram
    A SCARECROW-RETINOBLASTOMA protein network controls protective quiescence in the Arabidopsis root stem cell organizer.
    PLoS Biol., 2013. 11(11): p. e1001724
    [PMID:24302889]
  27. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  28. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  29. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]
  30. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]