PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G47140.1
Common NameGATA27, K14A3.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 470aa    MW: 52601.1 Da    PI: 6.3626
Description GATA transcription factor 27
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G47140.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.43.1e-16741135
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                 C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  AT5G47140.1  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGS 41
                 ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.6E-9155IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.81E-11546No hitNo description
CDDcd002022.00E-16654No hitNo description
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.3E-13740IPR013088Zinc finger, NHR/GATA-type
PfamPF003205.3E-14741IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139191.1E-10235329IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG SLVNYTPLHA RAEGDETEIE  60
DHRTQTVMIK GMSLNKKIPK RKPYQENFTV KRANLEFHTG FKRKALDEEA SNRSSSGSVV  120
SNSESCAQSN AWDSTFPCKR RTCVGRPKAA SSVEKLTKDL YTILQEQQSS CLSGTSEEDL  180
LFENETPMLL GHGSVLMRDP HSGAREEESE ASSLLVESSK SSSVHSVKFG GKAMKQEQVK  240
RSKSQVLGRH SSLLCSIDLK DVFNFDEFIE NFTEEEQQKL MKLLPQVDSV DRPDSLRSMF  300
ESSQFKENLS LFQQLVADGV FETNSSYAKL EDIKTLAKLA LSDPNKSHLL ESYYMLKRRE  360
IEDCVTTTSR VSSLSPSNNN SLVTIERPCE SLNQNFSETR GVMRSPKEVM KIRSKHTEEN  420
LENSVSSFKP VSCGGPLVFS YEDNDISDQD LLLDVPSNGS FPQAELLNMI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.505120.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453589450.0
Expression AtlasAT5G47140-
AtGenExpressAT5G47140-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G47140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G47140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2266420.0AK226642.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL07-38-K02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199525.20.0GATA transcription factor 27
SwissprotQ5PP380.0GAT27_ARATH; GATA transcription factor 27
TrEMBLQ0WVU50.0Q0WVU5_ARATH; Uncharacterized protein At5g47140
STRINGAT5G47140.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Representative plantOGRP27491530
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  3. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  4. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]