PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G46590.1
Common Nameanac096, NAC096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 292aa    MW: 33580.5 Da    PI: 4.9484
Description NAC domain containing protein 96
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G46590.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.5e-5361341128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeel+ +yLk+kveg ++el evi+ +d+y+++Pw+Lp k  + +++ ewyfF++rdkky++g r+nr tk+gyWkatgkd++++s++
  AT5G46590.1   6 LPPGFRFHPTDEELIEYYLKRKVEGLEIEL-EVIPVIDLYSFDPWELPdKsFLPNRDMEWYFFCSRDKKYPNGFRTNRGTKAGYWKATGKDRKITSRS 102
                  79****************************.99**************96435556888**************************************** PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++ +g +ktLvfykgrap g +++W+mheyrl
  AT5G46590.1 103 SSIIGYRKTLVFYKGRAPLGDRSNWIMHEYRL 134
                  ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-603158IPR003441NAC domain
PROSITE profilePS5100559.0996158IPR003441NAC domain
PfamPF023653.3E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI EYYLKRKVEG LEIELEVIPV IDLYSFDPWE LPDKSFLPNR  60
DMEWYFFCSR DKKYPNGFRT NRGTKAGYWK ATGKDRKITS RSSSIIGYRK TLVFYKGRAP  120
LGDRSNWIMH EYRLCDDDTS QGSQNLKGAF VLCRVAMKNE IKTNTKIRKI PSEQTIGSGE  180
SSGLSSRVTS PSRDETMPFH SFANPVSTET DSSNIWISPE FILDSSKDYP QIQDVASQCF  240
QQDFDFPIIG NQNMEFPAST SLDQNMDEFM QNGYWTNYGY DQTGLFGYSD FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-51615917166NAC domain-containing protein 19
4dul_A4e-51615917166NAC domain-containing protein 19
1ut7_B4e-51615917166NO APICAL MERISTEM PROTEIN
1ut7_A4e-51615917166NO APICAL MERISTEM PROTEIN
1ut4_B4e-51615917166NO APICAL MERISTEM PROTEIN
1ut4_A4e-51615917166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.512560.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453589260.0
Genevisible248855_at0.0
Expression AtlasAT5G46590-
AtGenExpressAT5G46590-
ATTED-IIAT5G46590-
Function -- GeneRIF ? help Back to Top
  1. ANAC096 cooperates with bZIP-type transcription factors in dehydration and osmotic stress responses.
    [PMID: 24285786]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00546DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G46590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G46590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0205550.0BT020555.1 Arabidopsis thaliana At5g46590 gene, complete cds.
GenBankBT0203050.0BT020305.1 Arabidopsis thaliana At5g46590 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199471.10.0NAC domain containing protein 96
SwissprotA4VCM08e-68NAC45_ARATH; NAC domain-containing protein 45
TrEMBLQ9LS240.0Q9LS24_ARATH; At5g46590
STRINGAT5G46590.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM21512777
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  4. Nemhauser JL,Hong F,Chory J
    Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses.
    Cell, 2006. 126(3): p. 467-75
    [PMID:16901781]
  5. Che P,Lall S,Howell SH
    Developmental steps in acquiring competence for shoot development in Arabidopsis tissue culture.
    Planta, 2007. 226(5): p. 1183-94
    [PMID:17581762]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  8. Xu ZY, et al.
    The Arabidopsis NAC transcription factor ANAC096 cooperates with bZIP-type transcription factors in dehydration and osmotic stress responses.
    Plant Cell, 2013. 25(11): p. 4708-24
    [PMID:24285786]