PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G43290.1
Common NameATWRKY49, MNL12.11, WRKY49
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 274aa    MW: 31580.6 Da    PI: 7.9236
Description WRKY DNA-binding protein 49
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G43290.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.62.9e-29114170258
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  dDgy+WrKYGqK++k+s++prsYY+Ct + C++kk+vers ++ ++ +itYeg H h
  AT5G43290.1 114 DDGYKWRKYGQKSIKNSPNPRSYYKCTNPICNAKKQVERSIDESNTYIITYEGFHFH 170
                  8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-27107170IPR003657WRKY domain
PROSITE profilePS5081126.257108173IPR003657WRKY domain
SuperFamilySSF1182904.32E-25111171IPR003657WRKY domain
SMARTSM007741.3E-34113172IPR003657WRKY domain
PfamPF031063.9E-24114170IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEEEGYQWAR RCGNNAVEDP FVYEPPLFFL PQDQHHMHGL MPNEDFIANK FVTSTLYSGP  60
RIQDIANALA LVEPLTHPVR EISKSTVPLL ERSTLSKVDR YTLKVKNNSN GMCDDGYKWR  120
KYGQKSIKNS PNPRSYYKCT NPICNAKKQV ERSIDESNTY IITYEGFHFH YTYPFFLPDK  180
TRQWPNKKTK IHKHNAQDMN KKSQTQEESK EAQLGELTNQ NHPVNKAQEN TPANLEEGLF  240
FPVDQCRPQQ GLLEDVVAPA MKNIPTRDSV LTAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-181121701674Probable WRKY transcription factor 4
2ayd_A3e-181121741375WRKY transcription factor 1
2lex_A3e-181121701674Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G43290
AtGenExpressAT5G43290
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G43290.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G43290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0104240.0BT010424.1 Arabidopsis thaliana At5g43290 mRNA, complete cds.
GenBankAK1764430.0AK176443.1 Arabidopsis thaliana mRNA for putative protein, complete cds, clone: RAFL24-21-D20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199143.10.0putative WRKY transcription factor 49
SwissprotQ9FHR70.0WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLQ67YM50.0Q67YM5_ARATH; Putative uncharacterized protein At5g43290
STRINGAT5G43290.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MalvidsOGEM94052637
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]