PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G43270.3
Common NameMNL12.9, SPL2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 419aa    MW: 46860.4 Da    PI: 8.7732
Description squamosa promoter binding protein-like 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G43270.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-40169244277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  CqvegC+ dls+ak+yhr+h++Ce hsk p+v+vsg+e+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk++
  AT5G43270.3 169 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRSCRRRLSDHNARRRKPN 244
                  **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-33164230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.795166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-38167247IPR004333Transcription factor, SBP-box
PfamPF031103.2E-31169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MECNAKPPFQ WELENLISFG TSTAEVPRKL KPMEWEIDGF DCTSLYSSSF AYAGSSGSDI  60
AHAFSKSSKS TSISSSSAEV RTHNFTSETG ESLPGEFAKG IDTSPSLELS FGSGDPVLGL  120
KLGKRTYFED FWEVENAKGL GLPVTLASSS VSPVKKSKSI PQRLQTPHCQ VEGCNLDLSS  180
AKDYHRKHRI CENHSKFPKV VVSGVERRFC QQCSRFHCLS EFDEKKRSCR RRLSDHNARR  240
RKPNPGRTYD GKPQVDFVWN RFALIHPRSE EKFIWPSSKH VPSRVLMPQP AKTEISDTEH  300
NRFGLLDPKT KTARAELFSK EKVTISSHMG ASQDLDGALS LLSNSTTWVS SSDQPRRFTL  360
DHHPSSNLQP VAHRSAAQLN SVSGYWQPDP PAVEGPTALH RNGVGQFNEN YFSLNQFYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261692421184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224241KKRSCRRRLSDHNARRRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865288140.0
Genevisible249144_at0.0
Expression AtlasAT5G43270-
AtGenExpressAT5G43270-
ATTED-IIAT5G43270-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development, weak increase during flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
TAIRmember of the SPL (squamosa-promoter binding protein-like) gene family, a novel gene family encoding DNA binding proteins and putative transcription factors. In conjunction with SPL10 and SPL11, SPL2 redundantly controls proper development of lateral organs in association with shoot maturation in the reproductive phase.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.
Function -- GeneRIF ? help Back to Top
  1. SPL10, SPL11 and SPL2 regulate morphological traits of cauline leaves and flowers, and control shoot maturation not only in the vegetative phase but also in the reproductive phase.
    [PMID: 19880401]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G43270.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157 (Probable). Up-regulated by Turnip mosaic virus P1/HC-Pro protein, that acts as an antagonist of miR156. {ECO:0000269|PubMed:12202040, ECO:0000269|PubMed:12586064, ECO:0000305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G13260(R), AT5G25620(R)
Regulation -- MicroRNA ? help Back to Top
Source Description
miRTarBaseRegulated by ath-miR156f
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G43270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0259840.0BT025984.1 Arabidopsis thaliana At5g43270 mRNA, complete cds.
GenBankAK2301600.0AK230160.1 Arabidopsis thaliana mRNA for squamosa promoter binding protein-like 2, complete cds, clone: RAFL22-87-G21.
GenBankAJ0116260.0AJ011626.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199141.10.0squamosa promoter-binding-like protein 2
RefseqNP_851122.10.0squamosa promoter-binding-like protein 2
RefseqNP_974875.10.0squamosa promoter-binding-like protein 2
SwissprotQ9S8400.0SPL2_ARATH; Squamosa promoter-binding-like protein 2
TrEMBLD7MP970.0D7MP97_ARALL; Putative uncharacterized protein
STRINGAT5G43270.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Rhoades MW, et al.
    Prediction of plant microRNA targets.
    Cell, 2002. 110(4): p. 513-20
    [PMID:12202040]
  4. Kasschau KD, et al.
    P1/HC-Pro, a viral suppressor of RNA silencing, interferes with Arabidopsis development and miRNA unction.
    Dev. Cell, 2003. 4(2): p. 205-17
    [PMID:12586064]
  5. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  6. Vazquez F,Gasciolli V,Cr
    The nuclear dsRNA binding protein HYL1 is required for microRNA accumulation and plant development, but not posttranscriptional transgene silencing.
    Curr. Biol., 2004. 14(4): p. 346-51
    [PMID:14972688]
  7. Yamasaki K, et al.
    A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors.
    J. Mol. Biol., 2004. 337(1): p. 49-63
    [PMID:15001351]
  8. Chen J,Li WX,Xie D,Peng JR,Ding SW
    Viral virulence protein suppresses RNA silencing-mediated defense but upregulates the role of microrna in host gene expression.
    Plant Cell, 2004. 16(5): p. 1302-13
    [PMID:15100397]
  9. Yoo BC, et al.
    A systemic small RNA signaling system in plants.
    Plant Cell, 2004. 16(8): p. 1979-2000
    [PMID:15258266]
  10. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  11. Schwarz S,Grande AV,Bujdoso N,Saedler H,Huijser P
    The microRNA regulated SBP-box genes SPL9 and SPL15 control shoot maturation in Arabidopsis.
    Plant Mol. Biol., 2008. 67(1-2): p. 183-95
    [PMID:18278578]
  12. Wang JW,Schwab R,Czech B,Mica E,Weigel D
    Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.
    Plant Cell, 2008. 20(5): p. 1231-43
    [PMID:18492871]
  13. Li LC, et al.
    SPOROCYTELESS modulates YUCCA expression to regulate the development of lateral organs in Arabidopsis.
    New Phytol., 2008. 179(3): p. 751-64
    [PMID:18557819]
  14. Shikata M,Koyama T,Mitsuda N,Ohme-Takagi M
    Arabidopsis SBP-box genes SPL10, SPL11 and SPL2 control morphological change in association with shoot maturation in the reproductive phase.
    Plant Cell Physiol., 2009. 50(12): p. 2133-45
    [PMID:19880401]
  15. Xing S,Salinas M,H
    miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis.
    Plant Cell, 2010. 22(12): p. 3935-50
    [PMID:21177480]
  16. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  17. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]