PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G42910.1
Common NameBZIP15, MBD2.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 370aa    MW: 41032.9 Da    PI: 9.8285
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G42910.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.7e-10294344454
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +k+ rrk+kNRe+A rsR+RK+a++ e e + ++L++  ++L k+  el+k
  AT5G42910.1 294 DKKLRRKIKNRESAARSRARKQAQTMEVEVELENLKKDYEELLKQHVELRK 344
                  699************************************999887777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-6291355IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.7E-11293345No hitNo description
PROSITE profilePS502179.99293345IPR004827Basic-leucine zipper domain
PfamPF001709.2E-8294344IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-8295344No hitNo description
CDDcd147072.90E-18295349No hitNo description
PROSITE patternPS000360298313IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MDSYWRLKNL VNDLPVSTSL SRQGSIYSWT VDQFQTSLGL DCGSMNMDEL VKHISSAEET  60
QEGSQRQGST TLPPTLSKQN VGEVWKSITE EKHTNNNGGV TNITHLQGQQ TLGEITLEEF  120
FIRAGARGGN TNGGSIHDSS SSISGNPHTS LGVQIQPKAM VSDFMNNMVP RSHDSYLHQN  180
VNGSMSTYQP QQSIMSMPNG YSYGKQIRFS NGSLGSGNQS LQDTKRSLVP SVATIPSEAI  240
TCSPVTPFPT LNGKQKINGE SSLLSPSPYI SNGSTSTRGG KINSEITAEK QFVDKKLRRK  300
IKNRESAARS RARKQAQTME VEVELENLKK DYEELLKQHV ELRKRQMEPG MISLHERPER  360
KLRRTKSDIK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.65240.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249170_at0.0
Expression AtlasAT5G42910-
AtGenExpressAT5G42910-
ATTED-IIAT5G42910-
Functional Description ? help Back to Top
Source Description
UniProtCould participate in abscisic acid-regulated gene expression. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G42910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G42910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4195990.0AJ419599.1 Arabidopsis thaliana mRNA for basic leucine zipper transcription factor (atbzip15 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199105.10.0Basic-leucine zipper (bZIP) transcription factor family protein
SwissprotQ9FMM70.0AI5L8_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 8
TrEMBLD7MQS10.0D7MQS1_ARALL; Predicted protein
STRINGAT5G42910.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156311417
Representative plantOGRP39841024
Publications ? help Back to Top
  1. Choi H,Hong J,Ha J,Kang J,Kim SY
    ABFs, a family of ABA-responsive element binding factors.
    J. Biol. Chem., 2000. 275(3): p. 1723-30
    [PMID:10636868]
  2. Finkelstein RR,Lynch TJ
    The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor.
    Plant Cell, 2000. 12(4): p. 599-609
    [PMID:10760247]
  3. Riechmann JL,Ratcliffe OJ
    A genomic perspective on plant transcription factors.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34
    [PMID:11019812]
  4. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  5. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  6. Bensmihen S, et al.
    The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.
    Plant Cell, 2002. 14(6): p. 1391-403
    [PMID:12084834]
  7. Brocard IM,Lynch TJ,Finkelstein RR
    Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response.
    Plant Physiol., 2002. 129(4): p. 1533-43
    [PMID:12177466]
  8. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  9. Fujita Y, et al.
    AREB1 Is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.
    Plant Cell, 2005. 17(12): p. 3470-88
    [PMID:16284313]
  10. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]