PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G42630.2
Common NameATS, KAN4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 223aa    MW: 25187.4 Da    PI: 9.718
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G42630.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32106159255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  AT5G42630.2 106 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 159
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.22E-15103159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28104159IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-24106159IPR006447Myb domain, plants
PfamPF002492.9E-7107158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020021anatomyintegument
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MMMLESRNSM RASNSVPDLS LQISLPNYHA GKPLHGGDRS STSSDSGSSL SDLSHENNFF  60
NKPLLSLGFD HHHQRRSNMF QPQIYGRDFK RSSSSMVGLK RSIRAPRMRW TSTLHAHFVH  120
AVQLLGGHER ATPKSVLELM NVKDLTLAHV KSHLQMYRTV KCTDKGSPGE GKVEKEAEQR  180
IEDNNNNEEA DEGTDTNSPN SSSVQKTQRL LFIYIFIFVK FCI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-17107161357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17107161357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17107161357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17107161357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-17107161458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306940940.0
Genevisible249206_at0.0
Expression AtlasAT5G42630-
AtGenExpressAT5G42630-
ATTED-IIAT5G42630-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During ovule development, first expressed in the inner integument primordium and then on the abaxial side of the inner integument. {ECO:0000269|PubMed:16623911}.
UniprotTISSUE SPECIFICITY: Expressed in the periphery of the primary root apex and lateral root. {ECO:0000269|PubMed:15286295}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the KANADI family of putative transcription factors. Involved in integument formation during ovule development and expressed at the boundary between the inner and outer integuments. It is essential for directing laminar growth of the inner integument.Along with KAN1 and KAN2, KAN4 is involved in proper localization of PIN1 in early embryogenesis.
UniProtProbable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}.
Function -- GeneRIF ? help Back to Top
  1. The Arabidopsis aberrant testa shape mutant encodes a member of the KANADI family of transcription factors (previously referred to as KAN4) that plays a role in integument growth.
    [PMID: 16623911]
  2. The results confirm that KAN4 is a regulatory protein which modulates the content of flavonols and PA in Arabidopsis seeds.
    [PMID: 20444210]
  3. ATS and ETT were found to share an overlapping expression pattern during Arabidopsis ovule development and loss of either gene resulted in congenital fusion of the integuments and altered seed morphology.
    [PMID: 22296848]
  4. ATS inhibits gibberellic acid biosynthesis.
    [PMID: 27794102]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBM26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G42630.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G23420(R), AT1G73590(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G42630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0486910.0AY048691.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI4 (KAN4) mRNA, complete cds.
GenBankBT0260530.0BT026053.1 Arabidopsis thaliana At5g42630 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001119363.11e-167Homeodomain-like superfamily protein
SwissprotQ9FJV51e-155KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A178UHG91e-144A0A178UHG9_ARATH; KAN4
STRINGAT5G42630.11e-153(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Eshed Y,Baum SF,Perea JV,Bowman JL
    Establishment of polarity in lateral organs of plants.
    Curr. Biol., 2001. 11(16): p. 1251-60
    [PMID:11525739]
  3. Leon-Kloosterziel KM,Keijzer CJ,Koornneef M
    A Seed Shape Mutant of Arabidopsis That Is Affected in Integument Development.
    Plant Cell, 1994. 6(3): p. 385-392
    [PMID:12244241]
  4. Sieber P,Petrascheck M,Barberis A,Schneitz K
    Organ polarity in Arabidopsis. NOZZLE physically interacts with members of the YABBY family.
    Plant Physiol., 2004. 135(4): p. 2172-85
    [PMID:15299139]
  5. McAbee JM, et al.
    ABERRANT TESTA SHAPE encodes a KANADI family member, linking polarity determination to separation and growth of Arabidopsis ovule integuments.
    Plant J., 2006. 46(3): p. 522-31
    [PMID:16623911]
  6. Izhaki A,Bowman JL
    KANADI and class III HD-Zip gene families regulate embryo patterning and modulate auxin flow during embryogenesis in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 495-508
    [PMID:17307928]
  7. Kelley DR,Skinner DJ,Gasser CS
    Roles of polarity determinants in ovule development.
    Plant J., 2009. 57(6): p. 1054-64
    [PMID:19054366]
  8. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  9. Gao P, et al.
    A new dominant Arabidopsis transparent testa mutant, sk21-D, and modulation of seed flavonoid biosynthesis by KAN4.
    Plant Biotechnol. J., 2010. 8(9): p. 979-93
    [PMID:20444210]
  10. Kelley DR,Arreola A,Gallagher TL,Gasser CS
    ETTIN (ARF3) physically interacts with KANADI proteins to form a functional complex essential for integument development and polarity determination in Arabidopsis.
    Development, 2012. 139(6): p. 1105-9
    [PMID:22296848]
  11. Enugutti B, et al.
    Regulation of planar growth by the Arabidopsis AGC protein kinase UNICORN.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(37): p. 15060-5
    [PMID:22927420]
  12. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  13. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  14. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  15. Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA
    Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS.
    Plant Physiol., 2016. 172(4): p. 2403-2415
    [PMID:27794102]