PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G41570.1
Common NameATWRKY24, MBK23.9, WRKY24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 179aa    MW: 20812.5 Da    PI: 8.4665
Description WRKY DNA-binding protein 24
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G41570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.23e-3297155159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk + +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+
  AT5G41570.1  97 LDDGYRWRKYGQKSVKHNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHP 155
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.5E-3284155IPR003657WRKY domain
SuperFamilySSF1182904.97E-2889156IPR003657WRKY domain
PROSITE profilePS5081129.01192157IPR003657WRKY domain
SMARTSM007744.4E-3797156IPR003657WRKY domain
PfamPF031061.2E-2598155IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MDREDINPML SRLDVENNNT FSSFVDKTLM MMPPSTFSGE VEPSSSSSWY PESFHVHAPP  60
LPPENDQIGE KGKELKEKRS RKVPRIAFHT RSDDDVLDDG YRWRKYGQKS VKHNAHPRSY  120
YRCTYHTCNV KKQVQRLAKD PNVVVTTYEG VHNHPCEKLM ETLNPLLRQL QFLSSFSNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2687154774Probable WRKY transcription factor 4
2lex_A3e-2687154774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.265120.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible262339_at1e-101
Expression AtlasAT5G41570-
AtGenExpressAT5G41570-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G41570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FFS3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G41570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0045950.0BT004595.1 Arabidopsis thaliana At5g41570 gene, complete cds.
GenBankAK2275220.0AK227522.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-13-N18.
GenBankAF4048640.0AF404864.1 Arabidopsis thaliana WRKY transcription factor 24 (WRKY24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198972.11e-134WRKY transcription factor 24
SwissprotQ9FFS31e-136WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLQ0WTM61e-134Q0WTM6_ARATH; Putative uncharacterized protein At5g41570
STRINGAT5G41570.11e-133(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Giancola S, et al.
    Characterization of a radish introgression carrying the Ogura fertility restorer gene Rfo in rapeseed, using the Arabidopsis genome sequence and radish genetic mapping.
    Theor. Appl. Genet., 2003. 107(8): p. 1442-51
    [PMID:12942173]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]