PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G41410.1
Common NameBEL1, BELL1, MYC6.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 611aa    MW: 69493.2 Da    PI: 6.9725
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G41410.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.8e-094114481954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  AT5G41410.1 411 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 448
                  554459******************************88 PP

2BELL106.22.2e-34269340172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  e++elqk+kakLls+lee+++rY +y+eq+++ +++Fea++glg a++Yt+lA++a+SrhFrcLkd +++qi
  AT5G41410.1 269 EFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAAAFEAAVGLGGAEIYTALASRAMSRHFRCLKDGLVGQI 340
                  679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075261.7E-42194336IPR006563POX domain
SMARTSM005741.1E-71200338IPR006563POX domain
PROSITE profilePS5007112.017389452IPR001356Homeobox domain
SMARTSM003895.6E-9392456IPR001356Homeobox domain
CDDcd000869.21E-11392453No hitNo description
SuperFamilySSF466893.38E-17393460IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-28395459IPR009057Homeodomain-like
PfamPF059208.1E-18409448IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000018anatomyovule primordium
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MARDQFYGHN NHHHQEQQHQ MINQIQGFDE TNQNPTDHHH YNHQIFGSNS NMGMMIDFSK  60
QQQIRMTSGS DHHHHHHQTS GGTDQNQLLE DSSSAMRLCN VNNDFPSEVN DERPPQRPSQ  120
GLSLSLSSSN PTSISLQSFE LRPQQQQQQG YSGNKSTQHQ NLQHTQMMMM MMNSHHQNNN  180
NNNHQHHNHH QFQIGSSKYL SPAQELLSEF CSLGVKESDE EVMMMKHKKK QKGKQQEEWD  240
TSHHSNNDQH DQSATTSSKK HVPPLHSLEF MELQKRKAKL LSMLEELKRR YGHYREQMRV  300
AAAAFEAAVG LGGAEIYTAL ASRAMSRHFR CLKDGLVGQI QATSQALGER EEDNRAVSIA  360
ARGETPRLRL LDQALRQQKS YRQMTLVDAH PWRPQRGLPE RAVTTLRAWL FEHFLHPYPS  420
DVDKHILARQ TGLSRSQVSN WFINARVRLW KPMIEEMYCE ETRSEQMEIT NPMMIDTKPD  480
PDQLIRVEPE SLSSIVTNPT SKSGHNSTHG TMSLGSTFDF SLYGNQAVTY AGEGGPRGDV  540
SLTLGLQRND GNGGVSLALS PVTAQGGQLF YGRDHIEEGP VQYSASMLDD DQVQNLPYRN  600
LMGAQLLHDI V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15398456563Homeobox protein Meis2
3k2a_B2e-15398456563Homeobox protein Meis2
4xrm_A2e-15398456563Homeobox protein Meis2
4xrm_B2e-15398456563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.245680.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306937940.0
Genevisible249309_at0.0
Expression AtlasAT5G41410-
AtGenExpressAT5G41410-
ATTED-IIAT5G41410-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Early expression is detected in the inflorescence apex of developing flowers and also in the ovule primordium and the integuments. {ECO:0000269|PubMed:8521490}.
UniprotTISSUE SPECIFICITY: Expressed in both floral and vegetative tissues. {ECO:0000269|PubMed:8521490}.
Functional Description ? help Back to Top
Source Description
TAIRHomeodomain protein required for ovule identity.Loss of function mutations show homeotic conversion of integuments to carpels.Forms heterodimers with STM and KNAT1. Interacts with AG-SEP heterodimers is thought to restrict WUS expression. BEL interacts with MADS box dimers composed of SEP1(or SEP3) and AG, SHP1, SHP2 and STK. The interaction of BEL1 with AG-SEP3 is required for proper integument development and specification of integument identity.
UniProtPlays a major role in ovule patterning and in determination of integument identity via its interaction with MADS-box factors. Formation of complex with AG-SEP dimers negatively regulates the carpel identity process and favors the maintenance of ovule identity. BEL1-STM complex maintains the indeterminacy of the inflorescence meristem. Required, with SPL, for cytokinin-induced PIN1 expression in ovules (PubMed:22786869). {ECO:0000269|PubMed:12244239, ECO:0000269|PubMed:17693535, ECO:0000269|PubMed:22786869}.
Function -- GeneRIF ? help Back to Top
  1. BEL1 interacts with the ovule identity MADS box factors when they dimerize with SEPALLATA proteins.
    [PMID: 17693535]
  2. The transcription factors BEL1 and SPL/NZZ, previously described as key regulators of ovule development, are needed for the auxin and cytokinin signaling pathways for the correct patterning of the ovule.
    [PMID: 22786869]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G41410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G23420(A), AT2G17950(R), AT4G18960(R)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G23380, AT1G24260, AT1G26260, AT1G62360, AT1G70510, AT1G75410
IntActSearch Q38897
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G41410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0492370.0AY049237.1 Arabidopsis thaliana AT5g41410/MYC6_12 mRNA, complete cds.
GenBankATU399440.0U39944.2 Arabidopsis thaliana homeobox protein (BEL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198957.10.0homeobox protein BEL1
SwissprotQ388970.0BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLD7MIV50.0D7MIV5_ARALL; Putative uncharacterized protein
STRINGAT5G41410.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MalvidsOGEM58662639
Publications ? help Back to Top
  1. Western TL,Haughn GW
    BELL1 and AGAMOUS genes promote ovule identity in Arabidopsis thaliana.
    Plant J., 1999. 18(3): p. 329-36
    [PMID:10377998]
  2. Villanueva JM, et al.
    INNER NO OUTER regulates abaxial- adaxial patterning in Arabidopsis ovules.
    Genes Dev., 1999. 13(23): p. 3160-9
    [PMID:10601041]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Bellaoui M, et al.
    The Arabidopsis BELL1 and KNOX TALE homeodomain proteins interact through a domain conserved between plants and animals.
    Plant Cell, 2001. 13(11): p. 2455-70
    [PMID:11701881]
  5. Balasubramanian S,Schneitz K
    NOZZLE links proximal-distal and adaxial-abaxial pattern formation during ovule development in Arabidopsis thaliana.
    Development, 2002. 129(18): p. 4291-300
    [PMID:12183381]
  6. Modrusan Z,Reiser L,Feldmann KA,Fischer RL,Haughn GW
    Homeotic Transformation of Ovules into Carpel-like Structures in Arabidopsis.
    Plant Cell, 1994. 6(3): p. 333-349
    [PMID:12244239]
  7. Robinson-Beers K,Pruitt RE,Gasser CS
    Ovule Development in Wild-Type Arabidopsis and Two Female-Sterile Mutants.
    Plant Cell, 1992. 4(10): p. 1237-1249
    [PMID:12297633]
  8. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  9. Meister RJ, et al.
    Definition and interactions of a positive regulatory element of the Arabidopsis INNER NO OUTER promoter.
    Plant J., 2004. 37(3): p. 426-38
    [PMID:14731261]
  10. Smith HM,Campbell BC,Hake S
    Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH.
    Curr. Biol., 2004. 14(9): p. 812-7
    [PMID:15120075]
  11. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  12. Scofield S,Dewitte W,Murray JA
    The KNOX gene SHOOT MERISTEMLESS is required for the development of reproductive meristematic tissues in Arabidopsis.
    Plant J., 2007. 50(5): p. 767-81
    [PMID:17461793]
  13. Wijeratne AJ, et al.
    Differential gene expression in Arabidopsis wild-type and mutant anthers: insights into anther cell differentiation and regulatory networks.
    Plant J., 2007. 52(1): p. 14-29
    [PMID:17666023]
  14. Brambilla V, et al.
    Genetic and molecular interactions between BELL1 and MADS box factors support ovule development in Arabidopsis.
    Plant Cell, 2007. 19(8): p. 2544-56
    [PMID:17693535]
  15. Kumar R, et al.
    The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins.
    Plant Cell, 2007. 19(9): p. 2719-35
    [PMID:17873098]
  16. Magnani E,Hake S
    KNOX lost the OX: the Arabidopsis KNATM gene defines a novel class of KNOX transcriptional regulators missing the homeodomain.
    Plant Cell, 2008. 20(4): p. 875-87
    [PMID:18398054]
  17. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  18. Brambilla V,Kater M,Colombo L
    Ovule integument identity determination in Arabidopsis.
    Plant Signal Behav, 2008. 3(4): p. 246-7
    [PMID:19704643]
  19. Brown RH,Nickrent DL,Gasser CS
    Expression of ovule and integument-associated genes in reduced ovules of Santalales.
    Evol. Dev., 2010 Mar-Apr. 12(2): p. 231-40
    [PMID:20433462]
  20. Fernandez-Calvino L, et al.
    Arabidopsis plasmodesmal proteome.
    PLoS ONE, 2011. 6(4): p. e18880
    [PMID:21533090]
  21. Tiwari A, et al.
    Parthenocarpic potential in Capsicum annuum L. is enhanced by carpelloid structures and controlled by a single recessive gene.
    BMC Plant Biol., 2011. 11: p. 143
    [PMID:22018057]
  22. Bencivenga S,Simonini S,Benkov
    The transcription factors BEL1 and SPL are required for cytokinin and auxin signaling during ovule development in Arabidopsis.
    Plant Cell, 2012. 24(7): p. 2886-97
    [PMID:22786869]
  23. Schiessl K,Kausika S,Southam P,Bush M,Sablowski R
    JAGGED controls growth anisotropyand coordination between cell sizeand cell cycle during plant organogenesis.
    Curr. Biol., 2012. 22(19): p. 1739-46
    [PMID:22902754]
  24. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  25. Ray A, et al.
    Arabidopsis floral homeotic gene BELL (BEL1) controls ovule development through negative regulation of AGAMOUS gene (AG).
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(13): p. 5761-5
    [PMID:7912435]
  26. Reiser L, et al.
    The BELL1 gene encodes a homeodomain protein involved in pattern formation in the Arabidopsis ovule primordium.
    Cell, 1995. 83(5): p. 735-42
    [PMID:8521490]