PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G40120.1
Common NameAGL76
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 385aa    MW: 44447.3 Da    PI: 9.3586
Description AGAMOUS-like 76
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G40120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.62.1e-25958251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 +++++s +++++s+R+++i+KKA+EL++LCd+e++vi+++++g+l+++++
  AT5G40120.1  9 SSSSYSLASTSLSNRLETIFKKASELCTLCDIEACVIYYGPDGELKTWPK 58
                 6899********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-6159IPR002100Transcription factor, MADS-box
PfamPF003195.0E-141756IPR002100Transcription factor, MADS-box
PROSITE profilePS500669.6991860IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-151894IPR002100Transcription factor, MADS-box
CDDcd002664.00E-172384No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MTMRSLPFSS SSYSLASTSL SNRLETIFKK ASELCTLCDI EACVIYYGPD GELKTWPKEK  60
EKVRDIALRY SQLNEALRSK KSVNLHGFLN KKKKKKKKGL KNPNNKRKTC LKKNVNVLKY  120
PLADHYPPDQ VSQLTQSLKL HVSKFQERLR FLESQKQTKP DHQSLTPSSL NHQTQSLNPR  180
QFSLFMYNHG DNTLSQISVS ASNFNQNYFS ALLEQSELKN QLMKQDGYDQ NQNMRMGDIT  240
NNNFQLPYFS KKEAVQESVN YFGMNQLMLK ELYGCDQNMC MGNINSNSFQ HPCVSKAQHY  300
SAVEGSVNNQ RQSELMQQEL CGYEQNMCFT NNNFQVSNKE AVQESVTNFG LMQHELYGCD  360
QNMSMGNIIN NSFQQRLKHR TRICE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19197KKKKKKK
291107KKKKKKKGLKNPNNKRK
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184219460.0
Genevisible249419_s_at1e-88
Expression AtlasAT5G40120-
AtGenExpressAT5G40120-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G40120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G49420, AT1G46408
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G40120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAY1412220.0AY141222.1 Arabidopsis thaliana MADS-box protein AGL76 mRNA, complete cds.
GenBankAB0106990.0AB010699.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MSN9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198828.10.0protein AGAMOUS-LIKE 76
SwissprotQ9FLL01e-173AGL75_ARATH; Agamous-like MADS-box protein AGL75
TrEMBLQ9FL190.0Q9FL19_ARATH; MADS-box protein AGL76
STRINGAT5G40120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Representative plantOGRP6766218
Publications ? help Back to Top
  1. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  2. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]