PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G39820.1
Common Nameanac094, MKM21.14, NAC094
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 337aa    MW: 38302.7 Da    PI: 8.6738
Description NAC domain containing protein 94
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G39820.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-52211472128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                   pGfrFhPtdeelv++yLk+kv +k+l++ + ik+vdiyk++PwdLpk ++ +ekewyf+++rd+ky++++r+nr+t  g+Wkatg+d++++s  +++
  AT5G39820.1  21 LPGFRFHPTDEELVSFYLKRKVLHKSLPF-DLIKKVDIYKYDPWDLPKLAAMGEKEWYFYCPRDRKYRNSTRPNRVTGGGFWKATGTDRPIYSLdSTR 117
                  69**************************9.99***************8778899**************************************985667 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   +glkk+Lvfy+gra kg+ktdW+mhe+rl
  AT5G39820.1 118 CIGLKKSLVFYRGRAAKGVKTDWMMHEFRL 147
                  7***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-5819191IPR003441NAC domain
PROSITE profilePS5100556.0220191IPR003441NAC domain
PfamPF023651.8E-2522147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVLVMDDEES NNVERYDDVV LPGFRFHPTD EELVSFYLKR KVLHKSLPFD LIKKVDIYKY  60
DPWDLPKLAA MGEKEWYFYC PRDRKYRNST RPNRVTGGGF WKATGTDRPI YSLDSTRCIG  120
LKKSLVFYRG RAAKGVKTDW MMHEFRLPSL SDSHHSSYPN YNNKKQHLNN NNNSKELPSN  180
DAWAICRIFK KTNAVSSQRS IPQSWVYPTI PDNNQQSHNN TATLLASSDV LSHISTRQNF  240
IPSPVNEPAS FTESAASYFA SQMLGVTYNT ARNNGTGDAL FLRNNGTGDA LVLSNNENNY  300
FNNLTGGLTH EVPNVRSMVM EETTGSEMSA TSYSTNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-532219317170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341880810.0
Genevisible249420_at0.0
Expression AtlasAT5G39820-
AtGenExpressAT5G39820-
ATTED-IIAT5G39820-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G39820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G39820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0168760.0AB016876.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKM21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198798.20.0NAC domain containing protein 94
SwissprotQ9FIW50.0NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLR0F9M70.0R0F9M7_9BRAS; Uncharacterized protein
STRINGAT5G39820.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Michel K,Abderhalden O,Bruggmann R,Dudler R
    Transcriptional changes in powdery mildew infected wheat and Arabidopsis leaves undergoing syringolin-triggered hypersensitive cell death at infection sites.
    Plant Mol. Biol., 2006. 62(4-5): p. 561-78
    [PMID:16941219]
  4. Ballvora A, et al.
    Comparative sequence analysis of Solanum and Arabidopsis in a hot spot for pathogen resistance on potato chromosome V reveals a patchwork of conserved and rapidly evolving genome segments.
    BMC Genomics, 2007. 8: p. 112
    [PMID:17474978]