PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G39700.1
Common NameAtMYB89, MYB89
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 190aa    MW: 22676.1 Da    PI: 10.2984
Description myb domain protein 89
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G39700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.33.6e-1357101247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g WT  Ed++l+++v+ +G+ +Wk I ++m   Rt  +c+ rw++ 
      AT5G39700.1  57 GHWTLSEDLKLKELVAVFGPQNWKFIGEKME-PRTSLSCRQRWFNQ 101
                      68*****************************.9**********996 PP

2Myb_DNA-binding52.89.4e-17109153248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++T eE+e+l++a+ ++G++ W++Ia+ ++ +Rt+  +k++w++++
      AT5G39700.1 109 RNFTDEEEEKLLRAHILYGNK-WSKIAKLFN-RRTDHAVKNHWHSLM 153
                      68*******************.*********.***********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.71851102IPR017930Myb domain
SuperFamilySSF466891.58E-2655149IPR009057Homeodomain-like
SMARTSM007179.6E-1255104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2257109IPR009057Homeodomain-like
PfamPF002494.3E-1257101IPR001005SANT/Myb domain
CDDcd001673.02E-1059100No hitNo description
PROSITE profilePS5129425.967103157IPR017930Myb domain
SMARTSM007176.1E-15107155IPR001005SANT/Myb domain
PfamPF002491.5E-14109152IPR001005SANT/Myb domain
CDDcd001671.65E-10110153No hitNo description
Gene3DG3DSA:1.10.10.601.4E-20110155IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MYLFMYKCNI VLEETHVFQN TPCDVSLQRP FNGFGENNAL PLRKMHQEEK KKKHRGGHWT  60
LSEDLKLKEL VAVFGPQNWK FIGEKMEPRT SLSCRQRWFN QLDPKINKRN FTDEEEEKLL  120
RAHILYGNKW SKIAKLFNRR TDHAVKNHWH SLMNRIIRKQ SASDIRSFDN IQNYQTSNFL  180
PGLCLLNTKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-26571575105MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-26571575105C-Myb DNA-Binding Domain
1msf_C5e-26571575105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233220.0
Genevisible249414_at0.0
Expression AtlasAT5G39700-
AtGenExpressAT5G39700-
ATTED-IIAT5G39700-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in organ boundaries. {ECO:0000269|PubMed:19542355}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB89).
UniProtProbable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}.
Function -- GeneRIF ? help Back to Top
  1. MYB89 functions as a negative regulator of seed oil accumulation during maturation in Arabidopsis seeds.
    [PMID: 27932421]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G39700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G39700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759950.0AF175995.1 Arabidopsis thaliana putative transcription factor (MYB89) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568569.11e-142myb domain protein 89
SwissprotQ9SEZ42e-46MY105_ARATH; Transcription factor MYB105
TrEMBLA0A178UAD51e-140A0A178UAD5_ARATH; MYB89
TrEMBLQ9SPG41e-140Q9SPG4_ARATH; Myb domain protein 89
STRINGAT5G39700.11e-141(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  5. Li D, et al.
    MYB89 Transcription Factor Represses Seed Oil Accumulation.
    Plant Physiol., 2017. 173(2): p. 1211-1225
    [PMID:27932421]
  6. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]