PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G39660.2
Common NameCDF2, DOF5.2, MIJ24.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 457aa    MW: 49808.1 Da    PI: 4.9386
Description cycling DOF factor 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G39660.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-39134193261
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  AT5G39660.2 134 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSP 193
                  7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31130191IPR003851Zinc finger, Dof-type
PfamPF027016.3E-32136192IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.612138192IPR003851Zinc finger, Dof-type
PROSITE patternPS013610140176IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MADPAIKLFG KTIPLPELGV VDSSSSYTGF LTETQIPVRL SDSCTGDDDD EEMGDSGLGR  60
EEGDDVGDGG GESETDKKEE KDSECQEESL RNESNDVTTT TSGITEKTET TKAAKTNEES  120
GGTACSQEGK LKKPDKILPC PRCNSMETKF CYYNNYNVNQ PRHFCKKCQR YWTAGGTMRN  180
VPVGAGRRKN KSPASHYNRH VSITSAEAMQ KVARTDLQHP NGANLLTFGS DSVLCESMAS  240
GLNLVEKSLL KTQTVLQEPN EGLKITVPLN QTNEEAGTVS PLPKVPCFPG PPPTWPYAWN  300
GVSWTILPFY PPPAYWSCPG VSPGAWNSFT WMPQPNSPSG SNPNSPTLGK HSRDENAAEP  360
GTAFDETESL GREKSKPERC LWVPKTLRID DPEEAAKSSI WETLGIKKDE NADTFGAFRS  420
STKEKSSLSE GRLPGRRPEL QANPAALSRS ANFHESS
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249415_at0.0
Expression AtlasAT5G39660-
AtGenExpressAT5G39660-
ATTED-IIAT5G39660-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
TAIRDof-type zinc finger domain-containing protein, identical to H-protein promoter binding factor-2a GI:3386546 from (Arabidopsis thaliana). Interacts with LKP2 and FKF1, but its overexpression does not change flowering time under short or long day conditions.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Function -- GeneRIF ? help Back to Top
  1. Data suggest that antagonism between GIGANTEA and DOF transcription factors contributes to photoperiodic flowering by modulating an underlying diurnal rhythm in CONSTANS transcript levels [CDF2].
    [PMID: 19619493]
  2. Detailed expression studies followed by phenotypic assays showed that the CDFs function downstream of GI, influencing responses to freezing temperatures and growth, but are not necessary for proper clock function.
    [PMID: 25600594]
  3. We conclude that CDF2 regulates a group of pri-miRNAs at both the transcriptional and posttranscriptional levels to maintain proper levels of their mature miRNAs to control plant development.
    [PMID: 26473486]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G39660.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q93ZL5
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Early flowering. {ECO:0000269|PubMed:19619493}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G39660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0157910.0BT015791.1 Arabidopsis thaliana At5g39660 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318708.10.0cycling DOF factor 2
RefseqNP_568567.10.0cycling DOF factor 2
RefseqNP_851106.10.0cycling DOF factor 2
SwissprotQ93ZL50.0CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A178UGH80.0A0A178UGH8_ARATH; CDF2
STRINGAT5G39660.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Rohde A, et al.
    Molecular phenotyping of the pal1 and pal2 mutants of Arabidopsis thaliana reveals far-reaching consequences on phenylpropanoid, amino acid, and carbohydrate metabolism.
    Plant Cell, 2004. 16(10): p. 2749-71
    [PMID:15377757]
  6. Imaizumi T,Schultz TF,Harmon FG,Ho LA,Kay SA
    FKF1 F-box protein mediates cyclic degradation of a repressor of CONSTANS in Arabidopsis.
    Science, 2005. 309(5732): p. 293-7
    [PMID:16002617]
  7. Chawade A,Br
    Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors.
    BMC Genomics, 2007. 8: p. 304
    [PMID:17764576]
  8. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  9. Borges F, et al.
    Comparative transcriptomics of Arabidopsis sperm cells.
    Plant Physiol., 2008. 148(2): p. 1168-81
    [PMID:18667720]
  10. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  11. Budhiraja R, et al.
    Substrates related to chromatin and to RNA-dependent processes are modified by Arabidopsis SUMO isoforms that differ in a conserved residue with influence on desumoylation.
    Plant Physiol., 2009. 149(3): p. 1529-40
    [PMID:19151129]
  12. Fornara F, et al.
    Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.
    Dev. Cell, 2009. 17(1): p. 75-86
    [PMID:19619493]
  13. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  14. Elrouby N,Bonequi MV,Porri A,Coupland G
    Identification of Arabidopsis SUMO-interacting proteins that regulate chromatin activity and developmental transitions.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(49): p. 19956-61
    [PMID:24255109]
  15. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  16. Fornara F, et al.
    The GI-CDF module of Arabidopsis affects freezing tolerance and growth as well as flowering.
    Plant J., 2015. 81(5): p. 695-706
    [PMID:25600594]
  17. Sun Z,Guo T,Liu Y,Liu Q,Fang Y
    The Roles of Arabidopsis CDF2 in Transcriptional and Posttranscriptional Regulation of Primary MicroRNAs.
    PLoS Genet., 2015. 11(10): p. e1005598
    [PMID:26473486]