PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G38800.1
Common NameAtbZIP43, bZIP43, K15E6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 165aa    MW: 19263.5 Da    PI: 5.6868
Description basic leucine-zipper 43
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G38800.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.89.5e-1372117550
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  ++++rk++NRe+ArrsR RK+ +++eL   v  L  eN++L  +l+
  AT5G38800.1  72 RKQKRKISNRESARRSRMRKQRQVDELWSQVMWLRDENHQLLRKLN 117
                  689************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-1068132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.43870133IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.84E-1272121No hitNo description
PfamPF001704.8E-1172118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-1072145No hitNo description
CDDcd147023.32E-1773121No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MQPSTNIFSL HGCPPSYLSH IPTSSPFCGQ NPNPFFSFET GVNTSQFMSL ISSNNSTSDE  60
AEENHKEIIN ERKQKRKISN RESARRSRMR KQRQVDELWS QVMWLRDENH QLLRKLNCVL  120
ESQEKVIEEN VQLKEETTEL KQMISDMQLQ NQSPFSCIRD DDDVV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18491RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.303830.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306932990.0
Genevisible249534_at0.0
Expression AtlasAT5G38800-
AtGenExpressAT5G38800-
ATTED-IIAT5G38800-
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00533DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G38800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G38800
IntActSearch Q9FMC2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G38800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0090480.0AB009048.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15E6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198696.11e-120basic leucine-zipper 43
SwissprotQ9FMC21e-122BZP43_ARATH; Basic leucine zipper 43
TrEMBLD7MJU51e-101D7MJU5_ARALL; BZIP transcription factor family protein
STRINGAT5G38800.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP31041129
MalvidsOGEM31122667
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  6. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  7. Scheible WR, et al.
    Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen.
    Plant Physiol., 2004. 136(1): p. 2483-99
    [PMID:15375205]
  8. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  9. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  10. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  11. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  12. Shen H,Cao K,Wang X
    A conserved proline residue in the leucine zipper region of AtbZIP34 and AtbZIP61 in Arabidopsis thaliana interferes with the formation of homodimer.
    Biochem. Biophys. Res. Commun., 2007. 362(2): p. 425-30
    [PMID:17719007]