PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G35770.1
Common NameMXH1.20, SAP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SAP
Protein Properties Length: 446aa    MW: 49306.5 Da    PI: 6.7443
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G35770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP752.53.3e-22924452454
          SAP   2 ssssssssseseegseggeggdassgesegpsssrqr.aanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravsrsdllwqrltr 98 
                  s+sss          ++++g + s+g +e+ps sr+r  an+vwpePfle+la+qva++as+s+G laaa+alanvf+vc+tw+avsrsd+lwq l+r
  AT5G35770.1   2 STSSS----------SSDNGAGGSGGVFEAPSPSRPRrGANDVWPEPFLESLAVQVAVNASTSAGLLAAAPALANVFRVCTTWHAVSRSDHLWQLLSR 89 
                  33333..........3344455566899******998799********************************************************** PP

          SAP  99 riWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavrlfdletrlhvstflpqhrdrlGr 196
                  ++W+rt+l++dtWr+e+iyrhrtarnfrtr+++y+tlqfdp+dvde   +d+lsCrcl+lsd ylaaGfadG+vrlf l++rlhv+t++p  rdr+Gr
  AT5G35770.1  90 QVWARTHLMHDTWRDEFIYRHRTARNFRTRTHTYFTLQFDPSDVDE---PDSLSCRCLTLSDLYLAAGFADGTVRLFLLNNRLHVRTLRPPLRDRFGR 184
                  ******************************************9998...689********************************************** PP

          SAP 197 fsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaeteelvfvGGsltdPeavmG 294
                  fsravsGivisdsrl+fat+dGdihva+idg  ++++r+a++Gd+vndGalvdf+G+grWwvGl+aGvpGrafhiWd+++ee++fvGG+ltdPeavmG
  AT5G35770.1 185 FSRAVSGIVISDSRLTFATMDGDIHVAEIDG--VGHTRTAYAGDIVNDGALVDFTGCGRWWVGLFAGVPGRAFHIWDCNSEETTFVGGTLTDPEAVMG 280
                  *******************************..66*************************************************************** PP

          SAP 295 WhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeer.rGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrg.aqrgvl 390
                  Wh+ltelt+++Gr+r++++etavaCt++r++v+dlrnqgv+++e+ee+ rGliv+++da++eayv++dsrG+a+vrrv++ ++vc+frv+g aqr+v+
  AT5G35770.1 281 WHTLTELTTSLGRLRISGNETAVACTRWRIMVIDLRNQGVIIGEDEEQrRGLIVTGFDANDEAYVRLDSRGNASVRRVNTQQTVCEFRVSGaAQRRVM 378
                  ******************************************99888779*****************************************9****** PP

          SAP 391 gCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavsss....dgtihlldfga 454
                  gCvn+ +al++agg++rvWe+e+ e ylys+rervgev+a+vaddrhvav+s+    +++ihl+dfga
  AT5G35770.1 379 GCVNRLHALMCAGGIMRVWEVERGE-YLYSIRERVGEVDAIVADDRHVAVASAsstaQSIIHLWDFGA 445
                  ***********************77.***********************98875666899*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF813833.11E-663114IPR001810F-box domain
Gene3DG3DSA:1.20.1280.504.9E-663129No hitNo description
SuperFamilySSF509781.74E-11138316IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.102.3E-9140226IPR015943WD40/YVTN repeat-like-containing domain
Gene3DG3DSA:2.130.10.102.3E-9349443IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509781.74E-11360442IPR017986WD40-repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000018anatomyovule primordium
PO:0000021anatomypetal primordium
PO:0000037anatomyshoot apex
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009046anatomyflower
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MSTSSSSSDN GAGGSGGVFE APSPSRPRRG ANDVWPEPFL ESLAVQVAVN ASTSAGLLAA  60
APALANVFRV CTTWHAVSRS DHLWQLLSRQ VWARTHLMHD TWRDEFIYRH RTARNFRTRT  120
HTYFTLQFDP SDVDEPDSLS CRCLTLSDLY LAAGFADGTV RLFLLNNRLH VRTLRPPLRD  180
RFGRFSRAVS GIVISDSRLT FATMDGDIHV AEIDGVGHTR TAYAGDIVND GALVDFTGCG  240
RWWVGLFAGV PGRAFHIWDC NSEETTFVGG TLTDPEAVMG WHTLTELTTS LGRLRISGNE  300
TAVACTRWRI MVIDLRNQGV IIGEDEEQRR GLIVTGFDAN DEAYVRLDSR GNASVRRVNT  360
QQTVCEFRVS GAAQRRVMGC VNRLHALMCA GGIMRVWEVE RGEYLYSIRE RVGEVDAIVA  420
DDRHVAVASA SSTAQSIIHL WDFGAL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO40338550.0
Genevisible249716_at0.0
Expression AtlasAT5G35770-
AtGenExpressAT5G35770-
ATTED-IIAT5G35770-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in inflorescence and floral meristems, young floral organ primordia, and later in ovule primordia.
Functional Description ? help Back to Top
Source Description
TAIRA recessive mutation in the Arabidopsis STERILE APETALA (SAP) causes severe aberrations in inflorescence and flower and ovule development.
UniProtTranscriptional regulator involved in the specification of floral identity. Acts as A class cadastral protein by repressing the C class floral homeotic gene AGAMOUS in the external flower organs in association with APETALA2 and other repressors. Is required to maintain floral meristem identity in concert with AGAMOUS. Interacts also with APETALA2 to ensure the normal development of ovule.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G35770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G18960(R)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G35770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2231250.0AJ223125.1 Arabidopsis thaliana mRNA for sterile apetala.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198426.10.0transcriptional regulator STERILE APETALA
SwissprotQ9FKH10.0SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLD7MHW00.0D7MHW0_ARALL; Predicted protein
STRINGAT5G35770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9756912
MalvidsOGEM110182634
Publications ? help Back to Top
  1. Byzova MV, et al.
    Arabidopsis STERILE APETALA, a multifunctional gene regulating inflorescence, flower, and ovule development.
    Genes Dev., 1999. 13(8): p. 1002-14
    [PMID:10215627]
  2. Krizek BA,Prost V,Macias A
    AINTEGUMENTA promotes petal identity and acts as a negative regulator of AGAMOUS.
    Plant Cell, 2000. 12(8): p. 1357-66
    [PMID:10948255]
  3. Durfee T, et al.
    The F-box-containing protein UFO and AGAMOUS participate in antagonistic pathways governing early petal development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(14): p. 8571-6
    [PMID:12826617]
  4. Jack T
    Molecular and genetic mechanisms of floral control.
    Plant Cell, 2004. 16 Suppl: p. S1-17
    [PMID:15020744]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Shatil-Cohen A,Attia Z,Moshelion M
    Bundle-sheath cell regulation of xylem-mesophyll water transport via aquaporins under drought stress: a target of xylem-borne ABA?
    Plant J., 2011. 67(1): p. 72-80
    [PMID:21401747]
  7. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  8. Wang Z, et al.
    SCF(SAP) controls organ size by targeting PPD proteins for degradation in Arabidopsis thaliana.
    Nat Commun, 2016. 7: p. 11192
    [PMID:27048938]