PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G35550.1
Common NameATMYB123, ATTT2, MOK9.18, MYB123, TT2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 258aa    MW: 29611.4 Da    PI: 8.9031
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G35550.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-171663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l d+++ +G g W+t ++  g++R++k+c++rw +yl
      AT5G35550.1 16 RGAWTDHEDKILRDYITTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYL 63
                     89********************************************97 PP

2Myb_DNA-binding52.41.2e-1669113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
      AT5G35550.1  69 RGNISSDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNSN 113
                      78999*****************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2891163IPR017930Myb domain
SuperFamilySSF466897.7E-2814110IPR009057Homeodomain-like
SMARTSM007174.0E-121565IPR001005SANT/Myb domain
PfamPF002491.8E-131663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-221770IPR009057Homeodomain-like
CDDcd001671.00E-81863No hitNo description
PROSITE profilePS5129424.56464118IPR017930Myb domain
SMARTSM007172.1E-1568116IPR001005SANT/Myb domain
PfamPF002491.5E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2371118IPR009057Homeodomain-like
CDDcd001671.59E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0009813Biological Processflavonoid biosynthetic process
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGKRATTSVR REELNRGAWT DHEDKILRDY ITTHGEGKWS TLPNQAGLKR CGKSCRLRWK  60
NYLRPGIKRG NISSDEEELI IRLHNLLGNR WSLIAGRLPG RTDNEIKNHW NSNLRKRLPK  120
TQTKQPKRIK HSTNNENNVC VIRTKAIRCS KTLLFSDLSL QKKSSTSPLP LKEQEMDQGG  180
SSLMGDLEFD FDRIHSEFHF PDLMDFDGLD CGNVTSLVSS NEILGELVPA QGNLDLNRPF  240
TSCHHRGDDE DWLRDFTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249704_at0.0
Expression AtlasAT5G35550-
AtGenExpressAT5G35550-
ATTED-IIAT5G35550-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis.
UniprotTISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems.
Functional Description ? help Back to Top
Source Description
TAIRTT2 encodes a R2R3 MYB domain putative transcription factor that acts as a key determinant in the proanthocyanidin accumulation of developing seed. It is thought that a ternary complex composed of TT2, TT8 and TTG1 is necessary for correct expression of BAN in seed endothelium.
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}.
Function -- GeneRIF ? help Back to Top
  1. AtMYB5 and TT2, as partially redundant in regulating this outer seed coat developmental process with MYB5 having the major role. MYB5 and TT2 are shown to be expressed in this outer seed coat domain.
    [PMID: 18992236]
  2. TT1 (TRANSPARENT TESTA1) interacts with the MYB transcription factor TT2.
    [PMID: 21477081]
  3. Loss of TT2 function results in more sufficient fatty acid synthesis.
    [PMID: 22879396]
  4. directly bound to the regulatory region of FUSCA3, and mediates the expression of numerous genes in the fatty acid biosynthesis pathway
    [PMID: 24397827]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G35550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G71030 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G61720(A), AT1G79840(A), AT2G37260(A), AT3G59030(A), AT4G09820(A), AT4G22880(A), AT5G42800(A)
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G63650EGL3 interacts with TT2.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G35550, AT1G34790, AT1G53230, AT1G63650
IntActSearch Q9FJA2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G35550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719810.0AF371981.2 Arabidopsis thaliana putative transcription factor MYB123 (MYB123) mRNA, complete cds.
GenBankAY5196300.0AY519630.1 Arabidopsis thaliana MYB transcription factor (At5g35550) mRNA, complete cds.
GenBankDQ4470000.0DQ447000.1 Arabidopsis thaliana clone pENTR221-At5g35550 myb family transcription factor (At5g35550) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198405.10.0Duplicated homeodomain-like superfamily protein
SwissprotQ9FJA20.0TT2_ARATH; Transcription factor TT2
TrEMBLA0A178UCY60.0A0A178UCY6_ARATH; TT2
STRINGAT5G35550.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Nesi N, et al.
    The TT8 gene encodes a basic helix-loop-helix domain protein required for expression of DFR and BAN genes in Arabidopsis siliques.
    Plant Cell, 2000. 12(10): p. 1863-78
    [PMID:11041882]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Nesi N,Jond C,Debeaujon I,Caboche M,Lepiniec L
    The Arabidopsis TT2 gene encodes an R2R3 MYB domain protein that acts as a key determinant for proanthocyanidin accumulation in developing seed.
    Plant Cell, 2001. 13(9): p. 2099-114
    [PMID:11549766]
  4. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  5. Abrahams S, et al.
    The Arabidopsis TDS4 gene encodes leucoanthocyanidin dioxygenase (LDOX) and is essential for proanthocyanidin synthesis and vacuole development.
    Plant J., 2003. 35(5): p. 624-36
    [PMID:12940955]
  6. Baudry A, et al.
    TT2, TT8, and TTG1 synergistically specify the expression of BANYULS and proanthocyanidin biosynthesis in Arabidopsis thaliana.
    Plant J., 2004. 39(3): p. 366-80
    [PMID:15255866]
  7. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  8. Sharma SB,Dixon RA
    Metabolic engineering of proanthocyanidins by ectopic expression of transcription factors in Arabidopsis thaliana.
    Plant J., 2005. 44(1): p. 62-75
    [PMID:16167896]
  9. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  10. Baudry A,Caboche M,Lepiniec L
    TT8 controls its own expression in a feedback regulation involving TTG1 and homologous MYB and bHLH factors, allowing a strong and cell-specific accumulation of flavonoids in Arabidopsis thaliana.
    Plant J., 2006. 46(5): p. 768-79
    [PMID:16709193]
  11. Wei YL, et al.
    Molecular cloning of Brassica napus TRANSPARENT TESTA 2 gene family encoding potential MYB regulatory proteins of proanthocyanidin biosynthesis.
    Mol. Biol. Rep., 2007. 34(2): p. 105-20
    [PMID:17115250]
  12. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  13. Bogs J,Jaffé FW,Takos AM,Walker AR,Robinson SP
    The grapevine transcription factor VvMYBPA1 regulates proanthocyanidin synthesis during fruit development.
    Plant Physiol., 2007. 143(3): p. 1347-61
    [PMID:17208963]
  14. Berger B, et al.
    A simplified method for the analysis of transcription factor-promoter interactions that allows high-throughput data generation.
    Plant J., 2007. 50(5): p. 911-6
    [PMID:17425717]
  15. Skirycz A, et al.
    Transcription factor AtDOF4;2 affects phenylpropanoid metabolism in Arabidopsis thaliana.
    New Phytol., 2007. 175(3): p. 425-38
    [PMID:17635218]
  16. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  17. Yoshida K, et al.
    Functional differentiation of Lotus japonicus TT2s, R2R3-MYB transcription factors comprising a multigene family.
    Plant Cell Physiol., 2008. 49(2): p. 157-69
    [PMID:18202001]
  18. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  19. Pang Y,Peel GJ,Sharma SB,Tang Y,Dixon RA
    A transcript profiling approach reveals an epicatechin-specific glucosyltransferase expressed in the seed coat of Medicago truncatula.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(37): p. 14210-5
    [PMID:18772380]
  20. Gonzalez A,Mendenhall J,Huo Y,Lloyd A
    TTG1 complex MYBs, MYB5 and TT2, control outer seed coat differentiation.
    Dev. Biol., 2009. 325(2): p. 412-21
    [PMID:18992236]
  21. Buer CS,Djordjevic MA
    Architectural phenotypes in the transparent testa mutants of Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(3): p. 751-63
    [PMID:19129166]
  22. Nesi N, et al.
    The promoter of the Arabidopsis thaliana BAN gene is active in proanthocyanidin-accumulating cells of the Brassica napus seed coat.
    Plant Cell Rep., 2009. 28(4): p. 601-17
    [PMID:19153740]
  23. Mellway RD,Tran LT,Prouse MB,Campbell MM,Constabel CP
    The wound-, pathogen-, and ultraviolet B-responsive MYB134 gene encodes an R2R3 MYB transcription factor that regulates proanthocyanidin synthesis in poplar.
    Plant Physiol., 2009. 150(2): p. 924-41
    [PMID:19395405]
  24. Arsovski AA,Villota MM,Rowland O,Subramaniam R,Western TL
    MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.
    J. Exp. Bot., 2009. 60(9): p. 2601-12
    [PMID:19401413]
  25. Zhao J,Dixon RA
    MATE transporters facilitate vacuolar uptake of epicatechin 3'-O-glucoside for proanthocyanidin biosynthesis in Medicago truncatula and Arabidopsis.
    Plant Cell, 2009. 21(8): p. 2323-40
    [PMID:19684242]
  26. Brueggemann J,Weisshaar B,Sagasser M
    A WD40-repeat gene from Malus x domestica is a functional homologue of Arabidopsis thaliana TRANSPARENT TESTA GLABRA1.
    Plant Cell Rep., 2010. 29(3): p. 285-94
    [PMID:20107808]
  27. Appelhagen I, et al.
    TRANSPARENT TESTA1 interacts with R2R3-MYB factors and affects early and late steps of flavonoid biosynthesis in the endothelium of Arabidopsis thaliana seeds.
    Plant J., 2011. 67(3): p. 406-19
    [PMID:21477081]
  28. Th
    A new system for fast and quantitative analysis of heterologous gene expression in plants.
    New Phytol., 2012. 193(2): p. 504-12
    [PMID:22023451]
  29. Jia L, et al.
    Proanthocyanidins inhibit seed germination by maintaining a high level of abscisic acid in Arabidopsis thaliana.
    J Integr Plant Biol, 2012. 54(9): p. 663-73
    [PMID:22765383]
  30. Chen M, et al.
    The effect of transparent TESTA2 on seed fatty acid biosynthesis and tolerance to environmental stresses during young seedling establishment in Arabidopsis.
    Plant Physiol., 2012. 160(2): p. 1023-36
    [PMID:22879396]
  31. Schaart JG, et al.
    Identification and characterization of MYB-bHLH-WD40 regulatory complexes controlling proanthocyanidin biosynthesis in strawberry (Fragaria
    New Phytol., 2013. 197(2): p. 454-67
    [PMID:23157553]
  32. Heppel SC, et al.
    Identification of key amino acids for the evolution of promoter target specificity of anthocyanin and proanthocyanidin regulating MYB factors.
    Plant Mol. Biol., 2013. 82(4-5): p. 457-71
    [PMID:23689818]
  33. Li S,Zachgo S
    TCP3 interacts with R2R3-MYB proteins, promotes flavonoid biosynthesis and negatively regulates the auxin response in Arabidopsis thaliana.
    Plant J., 2013. 76(6): p. 901-13
    [PMID:24118612]
  34. Wang Z, et al.
    TRANSPARENT TESTA2 regulates embryonic fatty acid biosynthesis by targeting FUSCA3 during the early developmental stage of Arabidopsis seeds.
    Plant J., 2014. 77(5): p. 757-69
    [PMID:24397827]
  35. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  36. Liu C,Jun JH,Dixon RA
    MYB5 and MYB14 Play Pivotal Roles in Seed Coat Polymer Biosynthesis in Medicago truncatula.
    Plant Physiol., 2014. 165(4): p. 1424-1439
    [PMID:24948832]
  37. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  38. Zhu Z, et al.
    Characterization of the cis elements in the proximal promoter regions of the anthocyanin pathway genes reveals a common regulatory logic that governs pathway regulation.
    J. Exp. Bot., 2015. 66(13): p. 3775-89
    [PMID:25911741]
  39. Liu Y,Shi Z,Maximova SN,Payne MJ,Guiltinan MJ
    Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao.
    BMC Plant Biol., 2015. 15: p. 160
    [PMID:26109181]
  40. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  41. Li Y, et al.
    Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis.
    Sci Rep, 2016. 6: p. 30514
    [PMID:27465838]
  42. Li C,Zhang B,Chen B,Ji L,Yu H
    Site-specific phosphorylation of TRANSPARENT TESTA GLABRA1 mediates carbon partitioning in Arabidopsis seeds.
    Nat Commun, 2018. 9(1): p. 571
    [PMID:29422671]