PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G32460.1
Common NameF18O9.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family B3
Protein Properties Length: 530aa    MW: 60887.8 Da    PI: 9.9073
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G32460.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.93.7e-1324951394
                 TT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
           B3 13 sgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                 +  +v+pk f +++  g ++ +     l++  +  +W++k+  ++++    +tkGW+eF+ a++L++ D++vF+++g+    l++
  AT5G32460.1 24 T-YIVIPKAFYSNYleGRQEGN--AAELRSdATEITWKIKI--DGRR----MTKGWEEFAVAHNLQVDDILVFRHEGN----LLF 95
                 4.48*******99996555444..5666654899*******..9998....9**********************7663....333 PP

2B344.92e-14150238797
                  .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  ++++ + + ++lp+ f+++ g++k +  +++l de+ r  ++kl+y+k+s+r+  ++GW+ F+  ng ++g f+ + l++ +++++v+++f
  AT5G32460.1 150 TASNQRVDSFYLPRGFTTSSGSSKLC-NEIILIDEKDRPSTLKLRYNKSSNRFCVSRGWRAFCCRNGYRTGCFLRIILVR-KGKTPVLRIF 238
                  6667777889*******999988866.5**********************************************999987.8888999998 PP

3B337.44.4e-12301390697
                  ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
           B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  +++++ +++ + lpk  +++ g++k + k+++++d++grs  + l+y+ +++r++ ++GWk F+  n+ k+g f+ + l++ +++++v+++f
  AT5G32460.1 301 VTASNQRHDSFHLPKGLTTSSGLSKLC-KKIIFMDQKGRSSILDLSYSISDDRFTVRRGWKAFCCRNEHKTGCFLRLILVQ-NGKTPVLRIF 390
                  5788999999***********999866.7**********************************************999998.6777899887 PP

4B350.63.5e-16434514485
                  E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
           B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                  v ++ ++l++++l lp +  +++ ++k+ + +++l++++gr+W + l+y+k+sgr+ +t+GWk+F++ang k g ++++kl+
  AT5G32460.1 434 VSVTVSNLSEDILHLPIRLSRSNLLDKKIH-EIVLMNKEGRTWILSLKYSKYSGRFRITRGWKSFCEANGQKPGCTFLLKLH 514
                  56788999***************7777775.9******************************************99999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.4E-187103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-177105IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.91211103IPR003340B3 DNA binding domain
CDDcd100171.08E-1312100No hitNo description
SMARTSM010191.6E-1614103IPR003340B3 DNA binding domain
PfamPF023625.9E-92594IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-12142236IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.671144241IPR003340B3 DNA binding domain
SMARTSM010192.0E-15145241IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-13145236IPR015300DNA-binding pseudobarrel domain
CDDcd100171.64E-12145239No hitNo description
PfamPF023627.4E-12149238IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-12291388IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-11295388IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.529296393IPR003340B3 DNA binding domain
SMARTSM010197.8E-13297393IPR003340B3 DNA binding domain
CDDcd100171.34E-8297391No hitNo description
PfamPF023621.4E-10301390IPR003340B3 DNA binding domain
SuperFamilySSF1019361.14E-15427514IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-17427518IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.379431530IPR003340B3 DNA binding domain
SMARTSM010191.0E-16432523IPR003340B3 DNA binding domain
PfamPF023624.1E-14433514IPR003340B3 DNA binding domain
CDDcd100171.28E-11441511No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0001078developmental stageplant embryo cotyledonary stage
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MTDAMFSSSA KPHFIKPMLP GFETYIVIPK AFYSNYLEGR QEGNAAELRS DATEITWKIK  60
IDGRRMTKGW EEFAVAHNLQ VDDILVFRHE GNLLFHVTPF GLSFCEILYS QRDEKDVKDT  120
TGKVTRSRTV KKNGKNECSS VDTDFVVPVT ASNQRVDSFY LPRGFTTSSG SSKLCNEIIL  180
IDEKDRPSTL KLRYNKSSNR FCVSRGWRAF CCRNGYRTGC FLRIILVRKG KTPVLRIFPL  240
ERDEDNIEKH SKKVKQEVEH EESVKEETNV ESGKLKRDRL LQKDPKNLCS TSQDTNFVVP  300
VTASNQRHDS FHLPKGLTTS SGLSKLCKKI IFMDQKGRSS ILDLSYSISD DRFTVRRGWK  360
AFCCRNEHKT GCFLRLILVQ NGKTPVLRIF PLERYENSIA KNSKKIKQEV EYESAKEEKN  420
LESLSLSDNS SFVVSVTVSN LSEDILHLPI RLSRSNLLDK KIHEIVLMNK EGRTWILSLK  480
YSKYSGRFRI TRGWKSFCEA NGQKPGCTFL LKLHLSMTRF DQDGVAWDKK
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246168_at0.0
Expression AtlasAT5G32460-
AtGenExpressAT5G32460-
ATTED-IIAT5G32460-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G32460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G32460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026881e-159CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0464321e-159AB046432.1 Arabidopsis thaliana DNA, chromosome 5 centromere region, clone:F22D12.
GenBankF18O91e-159AF296831.1 Arabidopsis thaliana BAC F18O9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154745.10.0transcriptional factor B3 family protein
SwissprotF4KFT60.0REML3_ARATH; B3 domain-containing protein REM-like 3
TrEMBLR0F3W10.0R0F3W1_9BRAS; Uncharacterized protein
STRINGAT5G32460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17423910
Representative plantOGRP2682231
Publications ? help Back to Top
  1. Swaminathan K,Peterson K,Jack T
    The plant B3 superfamily.
    Trends Plant Sci., 2008. 13(12): p. 647-55
    [PMID:18986826]