PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G29000.2
Common NameF3F24.100, PHL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 413aa    MW: 46221.3 Da    PI: 5.4333
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G29000.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.3e-33231285155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+l++ +gLt++hvkSHLQkYR+
  AT5G29000.2 231 KQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQKYRT 285
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.486228288IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-30229287IPR009057Homeodomain-like
SuperFamilySSF466893.05E-17229285IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-23231285IPR006447Myb domain, plants
PfamPF002498.0E-11233284IPR001005SANT/Myb domain
PfamPF143796.0E-22319365IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MTLANDFGYS TAMSSSYSAL HTSVEDRYHK LPNSFWVSSG QELMNNPVPC QSVSGGNSGG  60
YLFPSSSGYC NVSAVLPHGR NLQNQPPVST VPRDRLAMQD CPLIAQSSLI NHHPQEFIDP  120
LHEFFDFSDH VPVQNLQAES SGVRVDSSVE LHKKSEWQDW ADQLISVDDG SEPNWSELLG  180
DSSSHNPNSE IPTPFLDVPR LDITANQQQQ MVSSEDQLSG RNSSSSVATS KQRMRWTPEL  240
HEAFVEAVNQ LGGSERATPK AVLKLLNNPG LTIYHVKSHL QKYRTARYKP ETSEVTGEPQ  300
EKKMTSIEDI KSLDMKTSVE ITQALRLQME VQKRLHEQLE IQRSLQLQIE KQGRYLQMMF  360
EKQQKIQDNK SSSSEASPKQ CNGSFAEVEV GLETLTGDQN ESASASRKRV RED
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425681240.0
Genevisible246724_at0.0
Expression AtlasAT5G29000-
AtGenExpressAT5G29000-
ATTED-IIAT5G29000-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots. {ECO:0000269|PubMed:20838596}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Function -- GeneRIF ? help Back to Top
  1. PHR1 and PHL1 are partially redundant transcription factors acting as central integrators of phosphate starvation responses.
    [PMID: 20838596]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G29000.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G14920
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No effect on phosphate starvation responsiveness, due to the redundancy with PHR1. {ECO:0000269|PubMed:20838596}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G29000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0023440.0BT002344.1 Arabidopsis thaliana clone C104936 unknown protein (At5g29000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568512.30.0protein PHR1-LIKE 1
SwissprotQ8GUN50.0PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLQ94AL70.0Q94AL7_ARATH; Putative uncharacterized protein At5g29000 (Fragment)
STRINGAT5G29000.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rubio V, et al.
    A conserved MYB transcription factor involved in phosphate starvation signaling both in vascular plants and in unicellular algae.
    Genes Dev., 2001. 15(16): p. 2122-33
    [PMID:11511543]
  3. Rizhsky L, et al.
    When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress.
    Plant Physiol., 2004. 134(4): p. 1683-96
    [PMID:15047901]
  4. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  5. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  6. Bustos R, et al.
    A central regulatory system largely controls transcriptional activation and repression responses to phosphate starvation in Arabidopsis.
    PLoS Genet., 2010. 6(9): p. e1001102
    [PMID:20838596]
  7. Ou B, et al.
    A high-throughput screening system for Arabidopsis transcription factors and its application to Med25-dependent transcriptional regulation.
    Mol Plant, 2011. 4(3): p. 546-55
    [PMID:21343311]
  8. Elfving N, et al.
    The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(20): p. 8245-50
    [PMID:21536906]
  9. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  10. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  11. Kim DY,Scalf M,Smith LM,Vierstra RD
    Advanced proteomic analyses yield a deep catalog of ubiquitylation targets in Arabidopsis.
    Plant Cell, 2013. 25(5): p. 1523-40
    [PMID:23667124]
  12. Bournier M, et al.
    Arabidopsis ferritin 1 (AtFer1) gene regulation by the phosphate starvation response 1 (AtPHR1) transcription factor reveals a direct molecular link between iron and phosphate homeostasis.
    J. Biol. Chem., 2013. 288(31): p. 22670-80
    [PMID:23788639]
  13. Mar
    Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners.
    Plant Physiol., 2014. 166(2): p. 1022-32
    [PMID:25118255]
  14. Sun L,Song L,Zhang Y,Zheng Z,Liu D
    Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.
    Plant Physiol., 2016. 170(1): p. 499-514
    [PMID:26586833]