PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G27960.1
Common NameAGL90, F15F15.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 320aa    MW: 36729.7 Da    PI: 7.5359
Description AGAMOUS-like 90
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G27960.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.57.2e-18948342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i n++ r+++f kR+ngi+KK +ELS+LC+++++ +i+s+
  AT5G27960.1  9 IANERSRKTSFMKRKNGIFKKLHELSTLCGVQACALIYSP 48
                 89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR004042.2E-7121IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.713147IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-21158IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.15E-21293IPR002100Transcription factor, MADS-box
CDDcd002664.05E-30283No hitNo description
PfamPF003191.1E-16948IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-72136IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MKKVKLSLIA NERSRKTSFM KRKNGIFKKL HELSTLCGVQ ACALIYSPFI PVPESWPSRE  60
GAKKVASKFL EMPRTARTRK MMDQETHLME RITKAKEQLK NLAAENRELQ VRRFMFDCVE  120
GKMSQYRYDA KDLQDLLSCM NLYLDQLNGR IESIKENGES LLSSVSPFPT RIGVDEIGDE  180
SFSDSPIHST TRVVDTPNAT NPHVLAGDMT PFLDADANAN MNQVQYQAPN NLFNQIQREF  240
YNINLNLNLN LNSNQYLNQQ QSFMNPMVEQ HMNHVGGRES IPFVDRNYYN YNQLPAVDLA  300
STSYMPSTTD VYDPYINNNL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425681060.0
Genevisible246836_s_at1e-176
Expression AtlasAT5G27960-
AtGenExpressAT5G27960-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G27960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G60440, AT1G31630, AT1G31640, AT1G46408, AT1G48150, AT1G77980
IntActSearch Q7XJK5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G27960
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412490.0AY141249.1 Arabidopsis thaliana MADS-box protein AGL90 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198148.20.0AGAMOUS-like 90
SwissprotQ7XJK50.0AGL90_ARATH; Agamous-like MADS-box protein AGL90
TrEMBLC0SVR40.0C0SVR4_ARATH; Uncharacterized protein At5g27960 (Fragment)
STRINGAT5G27960.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  4. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  5. Boisson B,Giglione C,Meinnel T
    Unexpected protein families including cell defense components feature in the N-myristoylome of a higher eukaryote.
    J. Biol. Chem., 2003. 278(44): p. 43418-29
    [PMID:12912986]
  6. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Lehti-Shiu MD,Adamczyk BJ,Fernandez DE
    Expression of MADS-box genes during the embryonic phase in Arabidopsis.
    Plant Mol. Biol., 2005. 58(1): p. 89-107
    [PMID:16028119]
  9. Kang IH,Steffen JG,Portereiko MF,Lloyd A,Drews GN
    The AGL62 MADS domain protein regulates cellularization during endosperm development in Arabidopsis.
    Plant Cell, 2008. 20(3): p. 635-47
    [PMID:18334668]
  10. Walia H, et al.
    Dosage-dependent deregulation of an AGAMOUS-LIKE gene cluster contributes to interspecific incompatibility.
    Curr. Biol., 2009. 19(13): p. 1128-32
    [PMID:19559614]
  11. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  12. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]