PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G27130.1
Common NameAGL39
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 306aa    MW: 34352.7 Da    PI: 4.2188
Description AGAMOUS-like 39
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G27130.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.83.8e-102363444
                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                 e k +r vt skRr++++ KA  L+   +a++av + s+++
  AT5G27130.1 23 ETKEQRAVTCSKRRQTVFSKAADLCLISGANIAVFVTSPSD 63
                 77899********************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.1051262IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-191271IPR002100Transcription factor, MADS-box
CDDcd002663.26E-241397No hitNo description
SuperFamilySSF554556.54E-161495IPR002100Transcription factor, MADS-box
PfamPF003192.2E-92363IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MPSSDSTMMK KGTKRKIEIK KRETKEQRAV TCSKRRQTVF SKAADLCLIS GANIAVFVTS  60
PSDSSDVVYS FSGYSSAYEI ADCYLNRKPP PKIVNPAGSK LGFWWEDPDL YHSCDDLSEL  120
SIIEDRLQRM KKHVMACLEK EEKSQLVSSF DQNPNSTCSL DVEDCDGSSY SQIASTFTPN  180
SVNEYCSDQT FSSFHGDQNP NLSSPSFDQD CYSSLYQICG ESSSQVASFD QNPSSEIQGF  240
ETEEEINQIN LLLQETQTEA NVNLDDEICF WNDLSNDDVF GLNSYFGLDN TNAMINFGDS  300
DFRRHV
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306905450.0
Expression AtlasAT5G27130-
AtGenExpressAT5G27130-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G27130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G38740, AT5G58890, AT5G65330, AT1G60040, AT1G65330, AT1G69120, AT1G77080
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G27130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankTM021B040.0AF007271.1 Arabidopsis thaliana BAC TM021B04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198065.20.0AGAMOUS-like 39
TrEMBLF4K2U30.0F4K2U3_ARATH; AGAMOUS-like 39
STRINGAT5G27130.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63951442
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]