PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G26650.1
Common NameAGL36, F21E10.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41811.2 Da    PI: 6.286
Description AGAMOUS-like 36
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G26650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.21.9e-17948342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i n++ r+++f+kR+ gi+KK +ELS+LC+++++ +i+s+
  AT5G26650.1  9 IANERSRKTSFIKRKDGIFKKLHELSTLCGVQACALIYSP 48
                 89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-21158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.39147IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-6121IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-21293IPR002100Transcription factor, MADS-box
CDDcd002663.34E-31283No hitNo description
PfamPF003195.2E-16948IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-62136IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MKKVKLSLIA NERSRKTSFI KRKDGIFKKL HELSTLCGVQ ACALIYSPFI PVPESWPSRE  60
GAKKVASRFL EMPPTARTKK MMDQETYLME RITKAKEQLK NLAAENRELQ VRRFMFDCVE  120
GKMSQYHYDA KDLQDLQSCI NLYLDQLNGR IESIKENGES LLSSVSPFPT RIGVDEIGDE  180
SFSDSPIHAT TGVVDTLNAT NPHVLTGDMT PFLDADATAV TASSRFFDHI PYENMNMSQN  240
LHEPFQHLVP TNVCDFFQNQ NMNQVQYQAP NNLFNQIQRE FYNINLNLNL NLNSNQYLNQ  300
QQSFMNPMVE QHMNHVGGRE SIPFVDGNCY NYHQLPSNQL PAVDHASTSY MPSTTGVYDP  360
YINNNL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.490650.0silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO795978140.0
Genevisible246836_s_at1e-109
Expression AtlasAT5G26650-
AtGenExpressAT5G26650-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Function -- GeneRIF ? help Back to Top
  1. AGL36 parent-of-origin-dependent expression is controlled by the activity of METHYLTRANSFERASE1 (MET1) maintenance DNA methyltransferase and DEMETER (DME) DNA glycosylase.
    [PMID: 21379330]
  2. Studies indicate that AGL36 and AGL92 showed imprinted gene expression.
    [PMID: 24039992]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G26650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G60440, AT1G01530
IntActSearch Q7XJK6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G26650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankF21E100.0AF058914.1 Arabidopsis thaliana BAC F21E10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850880.20.0AGAMOUS-like 36
SwissprotQ7XJK60.0AGL36_ARATH; Agamous-like MADS-box protein AGL36
TrEMBLA0A178UI700.0A0A178UI70_ARATH; AGL36
STRINGAT5G26650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  4. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  5. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  6. Shirzadi R, et al.
    Genome-wide transcript profiling of endosperm without paternal contribution identifies parent-of-origin-dependent regulation of AGAMOUS-LIKE36.
    PLoS Genet., 2011. 7(2): p. e1001303
    [PMID:21379330]
  7. Yoshida T,Kawabe A
    Importance of gene duplication in the evolution of genomic imprinting revealed by molecular evolutionary analysis of the type I MADS-box gene family in Arabidopsis species.
    PLoS ONE, 2013. 8(9): p. e73588
    [PMID:24039992]
  8. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]