PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G26630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 218aa    MW: 25123.2 Da    PI: 10.4182
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G26630.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.31.3e-151050242
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 +ien++ r+ tf kR++g+lKKA+EL +LC++ +  ++ s+
  AT5G26630.1 10 FIENETARKSTFKKRKKGLLKKAQELGILCGVPIFAVVNSP 50
                 8*******************************999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.2E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.166149IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-23295IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-102338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000293anatomyguard cell
PO:0009046anatomyflower
PO:0009089anatomyendosperm
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MTRQKVKMTF IENETARKST FKKRKKGLLK KAQELGILCG VPIFAVVNSP YELNPEVWPS  60
REAANQVVSQ WKTMSVMDKT KKMVNQETFL QQRITKATES WKKLRKENKE LEMKNIMFDC  120
LSGKTLVSSI EKTELRDFGY VIEQQLKDVN RRIEILKRNN EPSSALVPVA APTTSSVMPV  180
VEMGSSSVGF YDKVRDQIQI TLNMKQTTND LDLNKKQW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125KKRKK
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246834_at0.0
Expression AtlasAT5G26630-
AtGenExpressAT5G26630-
ATTED-IIAT5G26630-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G26630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G26630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412460.0AY141246.1 Arabidopsis thaliana MADS-box protein AGL35 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankF21E100.0AF058914.1 Arabidopsis thaliana BAC F21E10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850882.21e-159MADS-box transcription factor family protein
SwissprotQ9FJK35e-54AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLQ7XJK71e-158Q7XJK7_ARATH; MADS-box protein AGL35
STRINGAT5G26630.11e-159(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  4. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  5. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  6. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  7. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]