PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G26580.1
Common NameAGL34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 345aa    MW: 39581.9 Da    PI: 6.0966
Description AGAMOUS-like-34
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G26580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.19.4e-181150342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i n++ r+++f kR+ngi+KK +ELS+LC+++++ +i+s+
  AT5G26580.1 11 IANEISRETSFMKRKNGIMKKLYELSTLCGVQACTLIYSP 50
                 89************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.577161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-22160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-18161IPR002100Transcription factor, MADS-box
CDDcd002661.22E-21271No hitNo description
PRINTSPR004041.8E-10323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGMKKVKLSL IANEISRETS FMKRKNGIMK KLYELSTLCG VQACTLIYSP FIPVPEFLEM  60
SPTARTRKMM NQETYLMERI TKAKEQLQNL VGANQELQVR RFMFDCVEGK MSQYRYDAKD  120
LQDLLSCINL YLDQLNGRIE ILKEHGDSLP SVSPFPTRIG VEETGDESSS DSPILATTGV  180
VDTPNATNPR VLVADTTHFL DANATAVTAP FGFSNHIQYK NMNMSQDLHR PFQHLVPTNF  240
CDFFQNQNMN QVQYQAPPND MFNQIQREFY NINLNQKSNQ YMNQQQPFMN PMVEQHMSHV  300
GGRESIPFMD GNYYNYNQLP VVDHGSTSYM PSTTGVYDPY FNNNL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425705450.0
Genevisible246836_s_at6e-47
Expression AtlasAT5G26580-
AtGenExpressAT5G26580-
Functional Description ? help Back to Top
Source Description
TAIRType I member of MADs box domain transcription factor family. This class lacks the K-domain required for dimerization that is characteristic of class II MADS box proteins.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G26580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G26580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412480.0AY141248.1 Arabidopsis thaliana MADS-box protein AGL34 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankF21E100.0AF058914.1 Arabidopsis thaliana BAC F21E10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850888.20.0AGAMOUS-like-34
SwissprotQ7XJK60.0AGL36_ARATH; Agamous-like MADS-box protein AGL36
TrEMBLQ7X9H20.0Q7X9H2_ARATH; AGAMOUS-like-34
STRINGAT5G26580.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Representative plantOGRP11413173
Publications ? help Back to Top
  1. Alvarez-Buylla ER, et al.
    An ancestral MADS-box gene duplication occurred before the divergence of plants and animals.
    Proc. Natl. Acad. Sci. U.S.A., 2000. 97(10): p. 5328-33
    [PMID:10805792]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  5. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  6. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]