PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G24930.1
Common NameATCOL4, BBX5, COL4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 406aa    MW: 44674.8 Da    PI: 7.194
Description CONSTANS-like 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G24930.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.45.1e-074880436
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                 + C+ +++  + l+C+ +  +lC +C ++ H  
  AT5G24930.1 48 KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAA 80
                 58***************************9954 PP

2zf-B_box27.27.9e-0990135342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                   ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  AT5G24930.1  90 VWMCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPV 135
                  689*****************************66899999999986 PP

3CCT69.77.2e-24339382144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  AT5G24930.1 339 REARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 382
                  9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.2E-134592IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4384592IPR000315B-box-type zinc finger
PfamPF006433.7E-54887IPR000315B-box-type zinc finger
CDDcd000218.43E-94992No hitNo description
PROSITE profilePS5011910.89388135IPR000315B-box-type zinc finger
PfamPF006434.0E-790135IPR000315B-box-type zinc finger
CDDcd000219.47E-1091135No hitNo description
SMARTSM003361.3E-1093135IPR000315B-box-type zinc finger
PROSITE profilePS5101716.767339381IPR010402CCT domain
PfamPF062038.3E-18339381IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MDPTWIDSLT RSCEANSNTN HKRKRERETL KHREKKKKRF RERKMASKLC DSCKSATAAL  60
YCRPDAAFLC LSCDSKVHAA NKLASRHARV WMCEVCEQAP AHVTCKADAA ALCVTCDRDI  120
HSANPLARRH ERVPVTPFYD SVSSDGSVKH TAVNFLDDCY FSDIDGNGSR EEEEEEAASW  180
LLLPNPKTTT TATAGIVAVT SAEEVPGDSP EMNTGQQYLF SDPDPYLDLD YGNVDPKVES  240
LEQNSSGTDG VVPVENRTVR IPTVNENCFE MDFTGGSKGF TYGGGYNCIS HSVSSSSMEV  300
GVVPDGGSVA DVSYPYGGPA TSGADPGTQR AVPLTSAERE ARVMRYREKR KNRKFEKTIR  360
YASRKAYAEM RPRIKGRFAK RTDTNESNDV VGHGGIFSGF GLVPTF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12238RKRERETLKHREKKKKR
23040KHREKKKKRFR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.214720.0floral meristem| flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306896670.0
Genevisible246977_at0.0
Expression AtlasAT5G24930-
AtGenExpressAT5G24930-
ATTED-IIAT5G24930-
Function -- GeneRIF ? help Back to Top
  1. AtCOL4 is an important regulator for plant tolerance to abiotic stress.
    [PMID: 25073793]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G24930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G24930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0526970.0AY052697.1 Arabidopsis thaliana AT5g24930/F6A4_140 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197875.20.0zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T90.0COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLC0SVQ40.0C0SVQ4_ARATH; Putative uncharacterized protein At5g24930 (Fragment)
STRINGAT5G24930.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Representative plantOGRP6911767
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Izawa T,Takahashi Y,Yano M
    Comparative biology comes into bloom: genomic and genetic comparison of flowering pathways in rice and Arabidopsis.
    Curr. Opin. Plant Biol., 2003. 6(2): p. 113-20
    [PMID:12667866]
  4. Hu W,Wang Y,Bowers C,Ma H
    Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis.
    Plant Mol. Biol., 2003. 53(4): p. 545-63
    [PMID:15010618]
  5. Fukamatsu Y, et al.
    Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies.
    Plant Cell Physiol., 2005. 46(8): p. 1340-9
    [PMID:15937324]
  6. Deal RB,Topp CN,McKinney EC,Meagher RB
    Repression of flowering in Arabidopsis requires activation of FLOWERING LOCUS C expression by the histone variant H2A.Z.
    Plant Cell, 2007. 19(1): p. 74-83
    [PMID:17220196]
  7. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]
  10. Brandão MM,Dantas LL,Silva-Filho MC
    AtPIN: Arabidopsis thaliana protein interaction network.
    BMC Bioinformatics, 2009. 10: p. 454
    [PMID:20043823]
  11. Elrouby N,Coupland G
    Proteome-wide screens for small ubiquitin-like modifier (SUMO) substrates identify Arabidopsis proteins implicated in diverse biological processes.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(40): p. 17415-20
    [PMID:20855607]
  12. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  13. Min JH,Chung JS,Lee KH,Kim CS
    The CONSTANS-like 4 transcription factor, AtCOL4, positively regulates abiotic stress tolerance through an abscisic acid-dependent manner in Arabidopsis.
    J Integr Plant Biol, 2015. 57(3): p. 313-24
    [PMID:25073793]