PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G24800.1
Common NameATBZIP9, BZIP9, BZO2H2, F6A4.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 277aa    MW: 30408.6 Da    PI: 5.3945
Description basic leucine zipper 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G24800.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.72.2e-17120171354
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  +lkr rr+ +NRe+A+rsR+RK++++  Le+ v++L++ N++L k+l   ++
  AT5G24800.1 120 DLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQLIDATQ 171
                  79*****************************************988765555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-13113173No hitNo description
SMARTSM003382.0E-15118182IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645120166IPR004827Basic-leucine zipper domain
PfamPF001702.5E-15120166IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.85E-12121171No hitNo description
CDDcd147021.55E-20123174No hitNo description
PROSITE patternPS000360125140IPR004827Basic-leucine zipper domain
PfamPF124985.2E-5189266IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003015anatomyprimary root differentiation zone
PO:0005417anatomyphloem
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MDNHTAKDIG MKRSASELAL QEYLTTSPLD PCFDLMNRDY TCELRDSLLW SEGLFPAGPF  60
RDAQSSICEN LSADSPVSAN KPEVRGGVRR TTSGSSHVNS DDEDAETEAG QSEMTNDPND  120
LKRIRRMNSN RESAKRSRRR KQEYLVDLET QVDSLKGDNS TLYKQLIDAT QQFRSAGTNN  180
RVLKSDVETL RVKVKLAEDL VARGSLTSSL NQLLQTHLSP PSHSISSLHY TGNTSPAITV  240
HSDQSLFPGM TLSGQNSSPG LGNVSSEAVS CVSDIWP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136141SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.490590.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453584110.0
Genevisible246962_s_at0.0
Expression AtlasAT5G24800-
AtGenExpressAT5G24800-
ATTED-IIAT5G24800-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Present in silique vasculature and funiculi. In the anthers, restricted to the connective tissue at pre- and post-dehiscence stages and detected in the vascular tissue of the stamen filament. {ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, young leaves, and flowers, mostly in vascular tissues (e.g. phloem). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
TAIREncodes bZIP protein BZO2H2.
UniProtTranscription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G24800.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G28770, AT5G49450, AT5G58080, AT1G75390
IntActSearch Q9FUD3
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G24800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2268730.0AK226873.1 Arabidopsis thaliana mRNA for bZIP protein BZO2H2, clone: RAFL09-07-B02.
GenBankAF3102230.0AF310223.1 Arabidopsis thaliana bZIP protein BZO2H2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568457.10.0basic leucine zipper 9
SwissprotQ9FUD30.0BZIP9_ARATH; Basic leucine zipper 9
TrEMBLD7M3890.0D7M389_ARALL; Putative uncharacterized protein
STRINGAT5G24800.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP69561017
MalvidsOGEM63702641
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Zik M,Irish VF
    Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action.
    Plant Cell, 2003. 15(1): p. 207-22
    [PMID:12509532]
  4. Vincentz M,Bandeira-Kobarg C,Gauer L,Schl
    Evolutionary pattern of angiosperm bZIP factors homologous to the maize Opaque2 regulatory protein.
    J. Mol. Evol., 2003. 56(1): p. 105-16
    [PMID:12569427]
  5. Lara P, et al.
    Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.
    J. Biol. Chem., 2003. 278(23): p. 21003-11
    [PMID:12657652]
  6. Rizhsky L, et al.
    When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress.
    Plant Physiol., 2004. 134(4): p. 1683-96
    [PMID:15047901]
  7. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  8. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  9. Ehlting J, et al.
    Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
    Plant J., 2005. 42(5): p. 618-40
    [PMID:15918878]
  10. Oono Y, et al.
    Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays.
    Funct. Integr. Genomics, 2006. 6(3): p. 212-34
    [PMID:16463051]
  11. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  12. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  13. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  14. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  15. Weltmeier F, et al.
    Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.
    EMBO J., 2006. 25(13): p. 3133-43
    [PMID:16810321]
  16. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  17. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  18. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  19. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  20. Weltmeier F, et al.
    Expression patterns within the Arabidopsis C/S1 bZIP transcription factor network: availability of heterodimerization partners controls gene expression during stress response and development.
    Plant Mol. Biol., 2009. 69(1-2): p. 107-19
    [PMID:18841482]
  21. Kirchler T, et al.
    The role of phosphorylatable serine residues in the DNA-binding domain of Arabidopsis bZIP transcription factors.
    Eur. J. Cell Biol., 2010 Feb-Mar. 89(2-3): p. 175-83
    [PMID:20047775]
  22. Kang SG,Price J,Lin PC,Hong JC,Jang JC
    The arabidopsis bZIP1 transcription factor is involved in sugar signaling, protein networking, and DNA binding.
    Mol Plant, 2010. 3(2): p. 361-73
    [PMID:20080816]
  23. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  24. Song QX, et al.
    Soybean GmbZIP123 gene enhances lipid content in the seeds of transgenic Arabidopsis plants.
    J. Exp. Bot., 2013. 64(14): p. 4329-41
    [PMID:23963672]
  25. Veerabagu M, et al.
    The interaction of the Arabidopsis response regulator ARR18 with bZIP63 mediates the regulation of PROLINE DEHYDROGENASE expression.
    Mol Plant, 2014. 7(10): p. 1560-77
    [PMID:24948556]