PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G24590.2
Common NameANAC091, K18P6.12, NAC091, TIP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 451aa    MW: 50890.7 Da    PI: 5.8496
Description TCV-interacting protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G24590.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.3e-50131411128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp+GfrF+Ptdeelv +yL+ k++g+++++ +vi+e+di+k+ePwdLp  + vk++++ew fF++ d+ky++g+r nrat +gyWkatgkd++++s k
  AT5G24590.2  13 LPVGFRFSPTDEELVRYYLRLKINGHDNDV-RVIREIDICKWEPWDLPdfSVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK 109
                  79*************************999.99***************6447888999**************************************99 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++ +g+k+tLvfy+grapkg++t W+mheyr+
  AT5G24590.2 110 TKIIGVKRTLVFYTGRAPKGTRTCWIMHEYRA 141
                  99****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-585164IPR003441NAC domain
PROSITE profilePS5100554.70513164IPR003441NAC domain
PfamPF023657.6E-2514140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0012505Cellular Componentendomembrane system
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MKEDMEVLSL ASLPVGFRFS PTDEELVRYY LRLKINGHDN DVRVIREIDI CKWEPWDLPD  60
FSVVKTTDSE WLFFCPLDRK YPSGSRMNRA TVAGYWKATG KDRKIKSGKT KIIGVKRTLV  120
FYTGRAPKGT RTCWIMHEYR ATEKDLDGTK SGQNPFVVCK LFKKQDIVNG AAEPEESKSC  180
EVEPAVSSPT VVDEVEMSEV SPVFPKTEET NPCDVAESSL VIPSECRSGY SVPEVTTTGL  240
DDIDWLSFME FDSPKLFSPL HSQVQSELGS SFNGLQSESS ELFKNHNEDY IQTQYGTNDA  300
DEYMSKFLDS FLDIPYEPEQ IPYEPQNLSS CNKINDESKR GIKIRARRAQ APGCAEQFVM  360
QGDASRRLRL QVNLNSHKSE TDSTQLQFIK KEVKDTTTET MTKGCGNFTR SKSRTSFIFK  420
KIAAMGCSYR GLFRVGVVAV VCVMSVCSLV A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-4731657166NO APICAL MERISTEM PROTEIN
1ut4_B4e-4731657166NO APICAL MERISTEM PROTEIN
1ut7_A4e-4731657166NO APICAL MERISTEM PROTEIN
1ut7_B4e-4731657166NO APICAL MERISTEM PROTEIN
3swm_A5e-47316510169NAC domain-containing protein 19
3swm_B5e-47316510169NAC domain-containing protein 19
3swm_C5e-47316510169NAC domain-containing protein 19
3swm_D5e-47316510169NAC domain-containing protein 19
3swp_A5e-47316510169NAC domain-containing protein 19
3swp_B5e-47316510169NAC domain-containing protein 19
3swp_C5e-47316510169NAC domain-containing protein 19
3swp_D5e-47316510169NAC domain-containing protein 19
4dul_A4e-4731657166NAC domain-containing protein 19
4dul_B4e-4731657166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.650250.0flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO94086000.0
Genevisible249746_at0.0
Expression AtlasAT5G24590-
AtGenExpressAT5G24590-
ATTED-IIAT5G24590-
Functional Description ? help Back to Top
Source Description
TAIRMember of NAc protein family. Interacts with turnip crinkle virus (TCV) capsid protein. Transcription factor involved in regulating the defense response of Arabidopsis to TCV.
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Function -- GeneRIF ? help Back to Top
  1. Results show that loss of TIP does not alter HR or resistance to TCV, but resulted in increased replication of TCV and Cucumber mosaic virus, suggesting that TIP may play a role in basal resistance but is not required for HRT-mediated signaling.
    [PMID: 18785827]
  2. Turnip crinkle virus coat protein inhibits the basal immune response in Arabidopsis by binding to the TIP protein.
    [PMID: 24418554]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G24590.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: (Microbial infection) Induced by bacterial pathogens type III effector proteins (TTEs) (PubMed:16553893). Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:16553893, ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Increased replication of turnip crinkle virus (TCV) and cucumber mosaic virus (CMV) (PubMed:18785827, PubMed:24418554). Normal HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Delayed flower development in antisense asTIP plants (PubMed:24418554). {ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G24590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0096830.0BT009683.1 Arabidopsis thaliana At5g24590 mRNA, complete cds.
GenBankBT0020120.0BT002012.1 Arabidopsis thaliana NAC2-like protein (At5g24590) mRNA, complete cds.
GenBankAF2810620.0AF281062.1 Arabidopsis thaliana TIP mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197847.30.0TCV-interacting protein
SwissprotQ9LKG80.0NAC91_ARATH; NAC domain-containing protein 91
TrEMBLD7M3670.0D7M367_ARALL; Tip
STRINGAT5G24590.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Representative plantOGRP9409612
Publications ? help Back to Top
  1. Ren T,Qu F,Morris TJ
    HRT gene function requires interaction between a NAC protein and viral capsid protein to confer resistance to turnip crinkle virus.
    Plant Cell, 2000. 12(10): p. 1917-26
    [PMID:11041886]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  5. Ernst HA,Olsen AN,Larsen S,Lo Leggio L
    Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.
    EMBO Rep., 2004. 5(3): p. 297-303
    [PMID:15083810]
  6. Ren T,Qu F,Morris TJ
    The nuclear localization of the Arabidopsis transcription factor TIP is blocked by its interaction with the coat protein of Turnip crinkle virus.
    Virology, 2005. 331(2): p. 316-24
    [PMID:15629774]
  7. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  8. Suzuki N, et al.
    Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c.
    Plant Physiol., 2005. 139(3): p. 1313-22
    [PMID:16244138]
  9. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  10. Ma S,Bohnert HJ
    Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression.
    Genome Biol., 2007. 8(4): p. R49
    [PMID:17408486]
  11. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  12. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  13. Jeong RD,Chandra-Shekara AC,Kachroo A,Klessig DF,Kachroo P
    HRT-mediated hypersensitive response and resistance to Turnip crinkle virus in Arabidopsis does not require the function of TIP, the presumed guardee protein.
    Mol. Plant Microbe Interact., 2008. 21(10): p. 1316-24
    [PMID:18785827]
  14. Kim MJ,Shin R,Schachtman DP
    A nuclear factor regulates abscisic acid responses in Arabidopsis.
    Plant Physiol., 2009. 151(3): p. 1433-45
    [PMID:19759343]
  15. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  16. Donze T,Qu F,Twigg P,Morris TJ
    Turnip crinkle virus coat protein inhibits the basal immune response to virus invasion in Arabidopsis by binding to the NAC transcription factor TIP.
    Virology, 2014. 449: p. 207-14
    [PMID:24418554]