PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G22380.1
Common Nameanac090, MWD9.18, NAC090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 235aa    MW: 26722 Da    PI: 5.7675
Description NAC domain containing protein 90
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G22380.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.22.6e-4361372128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                  + GfrF Pt+eelv++yL++++eg++  ++++vi+ +d+++veP++Lp+    +++++ ++w+fF++r++++a+g r++r+t sgyWkatg+  +v+s
  AT5G22380.1   6 TIGFRFYPTEEELVSFYLRNQLEGRSdDSMHRVIPVLDVFEVEPSHLPNvagvRCRGDAEQWFFFVPRQEREARGGRPSRTTGSGYWKATGSPGPVFS 103
                  57***********************95555677***************556666666888************************************** PP

          NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  k+++ +g kkt+vfy+g+ap+g+kt+W m+ey++
  AT5G22380.1 104 KDNKMIGAKKTMVFYTGKAPTGRKTKWKMNEYHA 137
                  ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.9635162IPR003441NAC domain
SuperFamilySSF1019413.4E-475161IPR003441NAC domain
PfamPF023654.0E-237136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MADEVTIGFR FYPTEEELVS FYLRNQLEGR SDDSMHRVIP VLDVFEVEPS HLPNVAGVRC  60
RGDAEQWFFF VPRQEREARG GRPSRTTGSG YWKATGSPGP VFSKDNKMIG AKKTMVFYTG  120
KAPTGRKTKW KMNEYHAVDE TVNASTIPKL RREFSLCRVY ITTGSSRAFD RRPEGVLQTE  180
RMLTSDVAVA ETSFRVESSL ETSISGGEHI DVSMNTEFVD GLSEPMWDWE QLTWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-32816723173NAC domain-containing protein 19
3swm_B8e-32816723173NAC domain-containing protein 19
3swm_C8e-32816723173NAC domain-containing protein 19
3swm_D8e-32816723173NAC domain-containing protein 19
3swp_A8e-32816723173NAC domain-containing protein 19
3swp_B8e-32816723173NAC domain-containing protein 19
3swp_C8e-32816723173NAC domain-containing protein 19
3swp_D8e-32816723173NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible249940_at0.0
Expression AtlasAT5G22380-
AtGenExpressAT5G22380-
ATTED-IIAT5G22380-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G22380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G22380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0869440.0AY086944.1 Arabidopsis thaliana clone 29829 mRNA, complete sequence.
GenBankAK1758060.0AK175806.1 Arabidopsis thaliana mRNA for NAC-domain protein-like, complete cds, clone: RAFL22-40-G20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197630.11e-175NAC domain-containing protein
SwissprotQ9FMR31e-177NAC90_ARATH; NAC domain-containing protein 90
TrEMBLQ680R11e-175Q680R1_ARATH; NAC-domain protein-like
STRINGAT5G22380.11e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP22781136
MalvidsOGEM14452893
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Kasukabe Y, et al.
    Overexpression of spermidine synthase enhances tolerance to multiple environmental stresses and up-regulates the expression of various stress-regulated genes in transgenic Arabidopsis thaliana.
    Plant Cell Physiol., 2004. 45(6): p. 712-22
    [PMID:15215506]