PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G22290.1
Common Nameanac089, FAN, FSQ6, MWD9.7, NAC089, T6G21.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 340aa    MW: 38046.1 Da    PI: 5.2049
Description NAC domain containing protein 89
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G22290.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.79.5e-49221472128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                   pGf+F+Ptd el+++yLk+k++g + ++ evi++++iy++ePwdLp k++ ++++ew+fF+ r kky++g++++ratk gyWkatgk+++v+s ++e
  AT5G22290.1  22 FPGFKFSPTDVELISYYLKRKMDGLERSV-EVIPDLEIYNFEPWDLPdKSIVKSDSEWFFFCARGKKYPHGSQNRRATKMGYWKATGKERDVKS-GSE 117
                  69************************999.99***************778888899**************************************.9** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  ++g+k+tLvf+ grapkge+tdW+mhey +
  AT5G22290.1 118 VIGTKRTLVFHIGRAPKGERTDWIMHEYCV 147
                  ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5411163IPR003441NAC domain
PROSITE profilePS5100551.68121164IPR003441NAC domain
PfamPF023657.5E-2523146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDTKAVGVSK DTAASMEAST VFPGFKFSPT DVELISYYLK RKMDGLERSV EVIPDLEIYN  60
FEPWDLPDKS IVKSDSEWFF FCARGKKYPH GSQNRRATKM GYWKATGKER DVKSGSEVIG  120
TKRTLVFHIG RAPKGERTDW IMHEYCVKGV SLDDAMVVCR VRRNKEYNSG TSQKAPKPNS  180
SAEKHAKVQN GATSSGSPSD WDNLVDFYLA GESGEKLLAE MAESSENLQV DNDEDFFADI  240
LRDEIINLDE AVMTGNTPNE VPTLESASME IRVLPLPNMI DKQMSSLLEE RPSQKKKGKD  300
ATESLSSCFV GLYSIKSVNK ARWDVIIGVV ALIAMLFYLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-402316519166NO APICAL MERISTEM PROTEIN
1ut4_B1e-402316519166NO APICAL MERISTEM PROTEIN
1ut7_A1e-402316519166NO APICAL MERISTEM PROTEIN
1ut7_B1e-402316519166NO APICAL MERISTEM PROTEIN
3swm_A1e-402316522169NAC domain-containing protein 19
3swm_B1e-402316522169NAC domain-containing protein 19
3swm_C1e-402316522169NAC domain-containing protein 19
3swm_D1e-402316522169NAC domain-containing protein 19
3swp_A1e-402316522169NAC domain-containing protein 19
3swp_B1e-402316522169NAC domain-containing protein 19
3swp_C1e-402316522169NAC domain-containing protein 19
3swp_D1e-402316522169NAC domain-containing protein 19
4dul_A1e-402316519166NAC domain-containing protein 19
4dul_B1e-402316519166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.73560.0bud| flower| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453582960.0
Genevisible249944_at0.0
Expression AtlasAT5G22290-
AtGenExpressAT5G22290-
ATTED-IIAT5G22290-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in plant cell division. {ECO:0000269|PubMed:16803883}.
Function -- GeneRIF ? help Back to Top
  1. Results indicated that ANAC089 was a membrane-tethered transcription factor and its truncated form was responsible for the physiological function in flowering time control.
    [PMID: 21046321]
  2. These results show that nuclear relocation of NAC089 promotes ER-stress-induced PCD, and both pro-survival and pro-death signals are elicited by bZIP28 and bZIP60 during plant ER stress response.
    [PMID: 24675811]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G22290.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q94F58
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G22290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0780060.0AY078006.1 Arabidopsis thaliana AT5g22290/MWD9_7 mRNA, complete cds.
GenBankAF3856850.0AF385685.1 Arabidopsis thaliana AT5g22290/MWD9_7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568414.10.0membrane-tethered transcription factor ANAC089
SwissprotQ94F580.0NAC89_ARATH; NAC domain-containing protein 89
TrEMBLR0HBJ40.0R0HBJ4_9BRAS; Uncharacterized protein
STRINGAT5G22290.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43092356
Representative plantOGRP10249610
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Rizhsky L, et al.
    When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress.
    Plant Physiol., 2004. 134(4): p. 1683-96
    [PMID:15047901]
  5. Smyczynski C, et al.
    The C terminus of the immunophilin PASTICCINO1 is required for plant development and for interaction with a NAC-like transcription factor.
    J. Biol. Chem., 2006. 281(35): p. 25475-84
    [PMID:16803883]
  6. Li J,Zhang J,Wang X,Chen J
    A membrane-tethered transcription factor ANAC089 negatively regulates floral initiation in Arabidopsis thaliana.
    Sci China Life Sci, 2010. 53(11): p. 1299-306
    [PMID:21046321]
  7. Li P, et al.
    Fructose sensitivity is suppressed in Arabidopsis by the transcription factor ANAC089 lacking the membrane-bound domain.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(8): p. 3436-41
    [PMID:21300879]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  9. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]
  10. Klein P,Seidel T,St
    The membrane-tethered transcription factor ANAC089 serves as redox-dependent suppressor of stromal ascorbate peroxidase gene expression.
    Front Plant Sci, 2012. 3: p. 247
    [PMID:23162559]
  11. Yang ZT, et al.
    The membrane-associated transcription factor NAC089 controls ER-stress-induced programmed cell death in plants.
    PLoS Genet., 2014. 10(3): p. e1004243
    [PMID:24675811]
  12. Jones AM, et al.
    Border control--a membrane-linked interactome of Arabidopsis.
    Science, 2014. 344(6185): p. 711-6
    [PMID:24833385]