PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G18300.1
Common Nameanac088, NAC088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 147aa    MW: 17549.8 Da    PI: 5.3717
Description NAC domain containing protein 88
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G18300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM76.37.3e-24171324127
          NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikev.diykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                  +frF+P++eel+ +yL +k+  ++ ++   +++  +iy  ePw+L+++ ++   e +ew++F+kr         +nr++k   Wkatg+ k+v+sk +
  AT5G18300.1  17 CFRFNPSEEELILDYLLPKLGFHQPNTIYLLEDRdNIYAKEPWRLNHT-ENdifEPNEWFYFVKR---------TNRKVK--GWKATGELKDVVSKkT 102
                  69*******************999888566888768*********842.2224467799999985.........667655..4**********99878 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyr 127
                  ge++g k+ L fy  +  +++ + W+m ey+
  AT5G18300.1 103 GEVIGKKRNLRFY-VEGDESKTSGWTMREYS 132
                  899**********.555556799*******7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-283143IPR003441NAC domain
PROSITE profilePS5100524.58414147IPR003441NAC domain
PfamPF023651.7E-1518132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MMPMTEEFYD EEEELGCFRF NPSEEELILD YLLPKLGFHQ PNTIYLLEDR DNIYAKEPWR  60
LNHTENDIFE PNEWFYFVKR TNRKVKGWKA TGELKDVVSK KTGEVIGKKR NLRFYVEGDE  120
SKTSGWTMRE YSSIGNQNQR LCHLKGP
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184185750.0
Expression AtlasAT5G18300-
AtGenExpressAT5G18300-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G18300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G18300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0516260.0AC051626.5 Genomic Sequence For Arabidopsis thaliana Clone F20L16 From Chromosome V, complete sequence.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankBT0293190.0BT029319.1 Arabidopsis thaliana At5g18300 mRNA, complete cds.
GenBankAB0122460.0AB012246.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MRG7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197331.11e-107NAC domain containing protein 88
TrEMBLQ9FK421e-107Q9FK42_ARATH; At5g18300
STRINGAT5G18300.11e-106(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14744821
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]