PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G18270.2
Common NameANAC087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 335aa    MW: 38202.3 Da    PI: 5.8912
Description Arabidopsis NAC domain containing protein 87
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G18270.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-55211481129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdee++++yLk+kv ++++++  ++ e+d++k+ePwdLp+k+k +eke yfF++rd+ky+tg r+nrat+sgyWkatgkdke+++ kg 
  AT5G18270.2  21 LPPGFRFHPTDEEIITCYLKEKVLNSRFTA-VAMGEADLNKCEPWDLPSKAKMGEKEFYFFCQRDRKYPTGMRTNRATESGYWKATGKDKEIFKGKGC 117
                  79*************************999.67***************99999*****************************************9*** PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfy+grapkgekt+Wvmheyrle
  AT5G18270.2 118 LVGMKKTLVFYRGRAPKGEKTNWVMHEYRLE 148
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6218173IPR003441NAC domain
PROSITE profilePS5100558.37821172IPR003441NAC domain
PfamPF023653.2E-2922147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAVVVEEGVV LNHGGEELVD LPPGFRFHPT DEEIITCYLK EKVLNSRFTA VAMGEADLNK  60
CEPWDLPSKA KMGEKEFYFF CQRDRKYPTG MRTNRATESG YWKATGKDKE IFKGKGCLVG  120
MKKTLVFYRG RAPKGEKTNW VMHEYRLEGK YSYYNLPKSA RDEWVVCRVF HKNNPSTTTQ  180
PMTRIPVEDF TRMDSLENID HLLDFSSLPP LIDPSFMSQT EQPNFKPINP PTYDISSPIQ  240
PHHFNSYQSI FNHQVFGSAS GSTYNNNNEM IKMEQSLVSV SQETCLSSDV NANMTTTTEV  300
SSGPVMKQEM GMMGMVNGSK SYEDLCDLRG DLWDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-511917615169NO APICAL MERISTEM PROTEIN
1ut4_B3e-511917615169NO APICAL MERISTEM PROTEIN
1ut7_A3e-511917615169NO APICAL MERISTEM PROTEIN
1ut7_B3e-511917615169NO APICAL MERISTEM PROTEIN
4dul_A3e-511917615169NAC domain-containing protein 19
4dul_B3e-511917615169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.235110.0leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250024_at0.0
Expression AtlasAT5G18270-
AtGenExpressAT5G18270-
ATTED-IIAT5G18270-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G18270.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G18270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0060700.0BT006070.1 Arabidopsis thaliana clone U20123 putative NAM (no apical meristem) protein (At5g18270) mRNA, complete cds.
GenBankBT0057130.0BT005713.1 Arabidopsis thaliana clone RAFL14-80-C22 (R20123) putative NAM (no apical meristem) protein (At5g18270) mRNA, complete cds.
GenBankAK2283690.0AK228369.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-80-C22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974800.10.0NAC domain containing protein 87
SwissprotQ9FLJ22e-95NC100_ARATH; NAC domain-containing protein 100
TrEMBLF4JWK60.0F4JWK6_ARATH; NAC domain containing protein 87
STRINGAT5G18270.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  4. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  5. Vanderauwera S, et al.
    Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis.
    Plant Physiol., 2005. 139(2): p. 806-21
    [PMID:16183842]
  6. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  7. Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
    ATR and ATM play both distinct and additive roles in response to ionizing radiation.
    Plant J., 2006. 48(6): p. 947-61
    [PMID:17227549]
  8. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  9. Zhao J, et al.
    Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus.
    Planta, 2007. 227(1): p. 13-24
    [PMID:17665211]
  10. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  11. Inz
    A subcellular localization compendium of hydrogen peroxide-induced proteins.
    Plant Cell Environ., 2012. 35(2): p. 308-20
    [PMID:21443605]
  12. Pei H, et al.
    An NAC transcription factor controls ethylene-regulated cell expansion in flower petals.
    Plant Physiol., 2013. 163(2): p. 775-91
    [PMID:23933991]