PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G18240.3
Common NameATMYR1, MYR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 396aa    MW: 44812 Da    PI: 6.6201
Description myb-related protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G18240.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.2e-344599155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprl+Wtp+LHerFveav+qLGG +kAtPkti+++m+++gLtl+h+kSHLQkYRl
  AT5G18240.3 45 KPRLKWTPDLHERFVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRL 99
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.15542102IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-3243100IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1744100IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-2445100IPR006447Myb domain, plants
PfamPF002491.0E-104798IPR001005SANT/Myb domain
PfamPF143791.0E-15146186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005417anatomyphloem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MYYHNQHQGK SILSSSRMPI SSERHPFLRG NGTGDSGLIL STDAKPRLKW TPDLHERFVE  60
AVNQLGGGDK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANSS LNKTSVMTMV  120
EENPPEVDES HSESLSIGPQ PSMNLPISDA LQMQIEVQRR LHEQLELRIE AQGKYLQSIL  180
EKAQETLGRQ NLGAAGIEAT KAQLSELVSK VSADYPDSSF LEPKELQNLH HQQMQKTYPP  240
NSSLDSCLTS SEGTQKAPKM LDNRLGLRTY IGDSTSEQKE IMEEPFFHRM ELTWAEEESL  300
RENHNRPYLS TMVNNAEPRI SSSRRSPGRL SIGVGLHEHR GRSSNNSEYT EERFNENNED  360
CKLETHTRTA LDLNTHDENY GTTRPKQFDL NGFSWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-2044101158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.75560.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250031_at0.0
Expression AtlasAT5G18240-
AtGenExpressAT5G18240-
ATTED-IIAT5G18240-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}.
Functional Description ? help Back to Top
Source Description
TAIREncodes MYR1 (MYR1).
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Function -- GeneRIF ? help Back to Top
  1. survey of the MYB proteins that interact with R/B-like Bbasic helix-loop-helix proteins
    [PMID: 15361138]
  2. MYR1 is the component of a light intensity-dependent pathway that interacts with light-quality and photoperiod pathways affecting flowering time and organ elongation.
    [PMID: 21255164]
  3. alternative splicing of MYR1 and MYR2 may result in changes in dimerization or protein folding resulting in changes in activity and abundance of MYR1 or MYR2 protein.
    [PMID: 24309816]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G18240.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G18240
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G18240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2918170.0AF291817.1 Arabidopsis thaliana MYR1 (MYR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850842.10.0myb-related protein 1
RefseqNP_974797.10.0myb-related protein 1
SwissprotQ9FK470.0PHLA_ARATH; Myb-related protein 1
TrEMBLD7LXT00.0D7LXT0_ARALL; Uncharacterized protein
STRINGAT5G18240.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Thelander M,Fredriksson D,Schouten J,Hoge JH,Ronne H
    Cloning by pathway activation in yeast: identification of an Arabidopsis thaliana F-box protein that can turn on glucose repression.
    Plant Mol. Biol., 2002. 49(1): p. 69-79
    [PMID:12008900]
  3. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  4. Zhao C,Craig JC,Petzold HE,Dickerman AW,Beers EP
    The xylem and phloem transcriptomes from secondary tissues of the Arabidopsis root-hypocotyl.
    Plant Physiol., 2005. 138(2): p. 803-18
    [PMID:15923329]
  5. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  6. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  7. Zhao C,Hanada A,Yamaguchi S,Kamiya Y,Beers EP
    The Arabidopsis Myb genes MYR1 and MYR2 are redundant negative regulators of flowering time under decreased light intensity.
    Plant J., 2011. 66(3): p. 502-15
    [PMID:21255164]
  8. Zhao C,Beers E
    Alternative splicing of Myb-related genes MYR1 and MYR2 may modulate activities through changes in dimerization, localization, or protein folding.
    Plant Signal Behav, 2013. 8(11): p. e27325
    [PMID:24309816]