PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G17490.1
Common NameAtRGL3, K3M16.60, RGL3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 523aa    MW: 57326.7 Da    PI: 4.4947
Description RGA-like protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G17490.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4332.3e-1321575161374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv++L++cAeav+ ++l+la+al++r+  la++++ +m ++a+yf+eALa+r++r        ++ps+++ + s ee+     f++ +P+lkf+h+ta
  AT5G17490.1 157 LVQALVACAEAVQLENLSLADALVKRVGLLAASQAGAMGKVATYFAEALARRIYR--------IHPSAAAIDPSFEEILQ-MNFYDSCPYLKFAHFTA 245
                  689****************************************************........55555554445555444.46*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIleav +++ vH+iD++++qG+QWpaL+qaLa Rp+gpps+R+Tgvg+p+  ++e ++e+g++La++A+++gv+f+fn l+++rl+dle++++++
  AT5G17490.1 246 NQAILEAVTTSRVVHVIDLGLNQGMQWPALMQALALRPGGPPSFRLTGVGNPS--NREGIQELGWKLAQLAQAIGVEFKFNGLTTERLSDLEPDMFET 341
                  ***************************************************88..9****************************************** PP

         GRAS 197 kp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++  E+l+Vn+v++lh +l++++s+e+    +L +vk ++P +v+vveqea+hn+  Fl+rf eal+yys+lfdsle ++   s++r+ +++++lgr+
  AT5G17490.1 342 RTeSETLVVNSVFELHPVLSQPGSIEK----LLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLEDGVVIPSQDRV-MSEVYLGRQ 434
                  *99************************....************************************************988888776.56677**** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  i n+va+eg++r+erhetl++Wr+r+++aGF pv+l+++a kqa+lll+  + +dgyrvee++gsl+l W+++pL+++SaW+
  AT5G17490.1 435 ILNLVATEGSDRIERHETLAQWRKRMGSAGFDPVNLGSDAFKQASLLLALSGgGDGYRVEENDGSLMLAWQTKPLIAASAWK 516
                  *********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.1E-3234100IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.0E-4134106No hitNo description
PROSITE profilePS5098564.222131495IPR005202Transcription factor GRAS
PfamPF035148.1E-130157516IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009030anatomycarpel
PO:0009032anatomypetal
PO:0009049anatomyinflorescence
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MKRSHQETSV EEEAPSMVEK LENGCGGGGD DNMDEFLAVL GYKVRSSDMA DVAQKLEQLE  60
MVLSNDIASS SNAFNDTVHY NPSDLSGWAQ SMLSDLNYYP DLDPNRICDL RPITDDDECC  120
SSNSNSNKRI RLGPWCDSVT SESTRSVVLI EETGVRLVQA LVACAEAVQL ENLSLADALV  180
KRVGLLAASQ AGAMGKVATY FAEALARRIY RIHPSAAAID PSFEEILQMN FYDSCPYLKF  240
AHFTANQAIL EAVTTSRVVH VIDLGLNQGM QWPALMQALA LRPGGPPSFR LTGVGNPSNR  300
EGIQELGWKL AQLAQAIGVE FKFNGLTTER LSDLEPDMFE TRTESETLVV NSVFELHPVL  360
SQPGSIEKLL ATVKAVKPGL VTVVEQEANH NGDVFLDRFN EALHYYSSLF DSLEDGVVIP  420
SQDRVMSEVY LGRQILNLVA TEGSDRIERH ETLAQWRKRM GSAGFDPVNL GSDAFKQASL  480
LLALSGGGDG YRVEENDGSL MLAWQTKPLI AASAWKLAAE LRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-541575164375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246432_at0.0
Expression AtlasAT5G17490-
AtGenExpressAT5G17490-
ATTED-IIAT5G17490-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at very low level. Mainly expressed in germinating seeds and flowers and siliques. Not expressed in other tissues. {ECO:0000269|PubMed:11826301}.
Functional Description ? help Back to Top
Source Description
TAIRDELLA subfamily member involved in GA signal transduction
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Its activity may be regulated by phytohormones such as auxin and ethylene (By similarity). {ECO:0000250, ECO:0000269|PubMed:12610625, ECO:0000269|PubMed:14615596}.
Function -- GeneRIF ? help Back to Top
  1. Data documented that Lys-29 of ubiquitin is the major site for ubiquitin chain formation to mediate DELLA protein degradation that also required protein Ser/Thr dephosphorylation activity. The LZ domain is essential for both their stability and activity.
    [PMID: 19717618]
  2. MYC2 regulates RGL3 expression through a direct association with its promotor. RGL3 positively regulates jasmonate-mediated disease resistance.
    [PMID: 22892320]
  3. PIF3 lies downstream of PHYB and RGL3, and plays an important role in the inhibitory effect of NO on root growth of Arabidopsis seedlings in light.
    [PMID: 24157606]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G17490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G12610 (A), AT4G25470 (A), AT4G25480 (A), AT4G25490 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDgibberellin
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G54230, AT5G66730, AT1G09530, AT1G10585, AT1G32640, AT1G53170, AT1G75080
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Rga, gai, rgl1, rgl2 and rgl3 pentuple mutant displays constitutive GA responses even in the absence of GA treatment. {ECO:0000269|PubMed:23482857}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G17490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankBT0059050.0BT005905.1 Arabidopsis thaliana At5g17490 gene, complete cds.
GenBankAL3911500.0AL391150.1 Arabidopsis thaliana DNA chromosome 5, BAC clone K3M16 (ESSA project).
GenBankAK1172260.0AK117226.1 Arabidopsis thaliana At5g17490 mRNA for RGA-like protein, complete cds, clone: RAFL16-78-A02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197251.10.0DELLA protein RGL3
SwissprotQ9LF530.0RGL3_ARATH; DELLA protein RGL3
TrEMBLD7LX130.0D7LX13_ARALL; Putative uncharacterized protein
STRINGAT5G17490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MalvidsOGEM83728121
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dill A,Sun T
    Synergistic derepression of gibberellin signaling by removing RGA and GAI function in Arabidopsis thaliana.
    Genetics, 2001. 159(2): p. 777-85
    [PMID:11606552]
  3. Wen CK,Chang C
    Arabidopsis RGL1 encodes a negative regulator of gibberellin responses.
    Plant Cell, 2002. 14(1): p. 87-100
    [PMID:11826301]
  4. Lee S, et al.
    Gibberellin regulates Arabidopsis seed germination via RGL2, a GAI/RGA-like gene whose expression is up-regulated following imbibition.
    Genes Dev., 2002. 16(5): p. 646-58
    [PMID:11877383]
  5. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  6. Fu X,Harberd NP
    Auxin promotes Arabidopsis root growth by modulating gibberellin response.
    Nature, 2003. 421(6924): p. 740-3
    [PMID:12610625]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Achard P,Vriezen WH,Van Der Straeten D,Harberd NP
    Ethylene regulates arabidopsis development via the modulation of DELLA protein growth repressor function.
    Plant Cell, 2003. 15(12): p. 2816-25
    [PMID:14615596]
  9. Tyler L, et al.
    Della proteins and gibberellin-regulated seed germination and floral development in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 1008-19
    [PMID:15173565]
  10. Nakajima M, et al.
    Identification and characterization of Arabidopsis gibberellin receptors.
    Plant J., 2006. 46(5): p. 880-9
    [PMID:16709201]
  11. Penfield S,Gilday AD,Halliday KJ,Graham IA
    DELLA-mediated cotyledon expansion breaks coat-imposed seed dormancy.
    Curr. Biol., 2006. 16(23): p. 2366-70
    [PMID:17141619]
  12. Al-Samarrai TH,Kirk CA,Jones WT,Harvey D,Sun X
    Expression in Escherichia coli and in vitro refolding of the plant transcription factor Arabidopsis thaliana RGL3.
    Protein Expr. Purif., 2007. 53(2): p. 289-92
    [PMID:17317218]
  13. Hussain A,Cao D,Peng J
    Identification of conserved tyrosine residues important for gibberellin sensitivity of Arabidopsis RGL2 protein.
    Planta, 2007. 226(2): p. 475-83
    [PMID:17333251]
  14. Feng S, et al.
    Coordinated regulation of Arabidopsis thaliana development by light and gibberellins.
    Nature, 2008. 451(7177): p. 475-9
    [PMID:18216856]
  15. Bassel GW, et al.
    Elucidating the germination transcriptional program using small molecules.
    Plant Physiol., 2008. 147(1): p. 143-55
    [PMID:18359847]
  16. Magome H,Yamaguchi S,Hanada A,Kamiya Y,Oda K
    The DDF1 transcriptional activator upregulates expression of a gibberellin-deactivating gene, GA2ox7, under high-salinity stress in Arabidopsis.
    Plant J., 2008. 56(4): p. 613-26
    [PMID:18643985]
  17. Achard P, et al.
    The cold-inducible CBF1 factor-dependent signaling pathway modulates the accumulation of the growth-repressing DELLA proteins via its effect on gibberellin metabolism.
    Plant Cell, 2008. 20(8): p. 2117-29
    [PMID:18757556]
  18. Wang F, et al.
    Biochemical insights on degradation of Arabidopsis DELLA proteins gained from a cell-free assay system.
    Plant Cell, 2009. 21(8): p. 2378-90
    [PMID:19717618]
  19. Josse EM, et al.
    A DELLA in disguise: SPATULA restrains the growth of the developing Arabidopsis seedling.
    Plant Cell, 2011. 23(4): p. 1337-51
    [PMID:21478445]
  20. Siddiqua M,Nassuth A
    Vitis CBF1 and Vitis CBF4 differ in their effect on Arabidopsis abiotic stress tolerance, development and gene expression.
    Plant Cell Environ., 2011. 34(8): p. 1345-59
    [PMID:21486303]
  21. Feurtado JA, et al.
    The Arabidopsis C2H2 zinc finger INDETERMINATE DOMAIN1/ENHYDROUS promotes the transition to germination by regulating light and hormonal signaling during seed maturation.
    Plant Cell, 2011. 23(5): p. 1772-94
    [PMID:21571950]
  22. Li KL, et al.
    GsGASA1 mediated root growth inhibition in response to chronic cold stress is marked by the accumulation of DELLAs.
    J. Plant Physiol., 2011. 168(18): p. 2153-60
    [PMID:21855169]
  23. Dutilleul C, et al.
    Phytosphingosine-phosphate is a signal for AtMPK6 activation and Arabidopsis response to chilling.
    New Phytol., 2012. 194(1): p. 181-91
    [PMID:22236066]
  24. Hong GJ,Xue XY,Mao YB,Wang LJ,Chen XY
    Arabidopsis MYC2 interacts with DELLA proteins in regulating sesquiterpene synthase gene expression.
    Plant Cell, 2012. 24(6): p. 2635-48
    [PMID:22669881]
  25. Wild M, et al.
    The Arabidopsis DELLA RGA-LIKE3 is a direct target of MYC2 and modulates jasmonate signaling responses.
    Plant Cell, 2012. 24(8): p. 3307-19
    [PMID:22892320]
  26. Li QF, et al.
    An interaction between BZR1 and DELLAs mediates direct signaling crosstalk between brassinosteroids and gibberellins in Arabidopsis.
    Sci Signal, 2012. 5(244): p. ra72
    [PMID:23033541]
  27. Park J,Nguyen KT,Park E,Jeon JS,Choi G
    DELLA proteins and their interacting RING Finger proteins repress gibberellin responses by binding to the promoters of a subset of gibberellin-responsive genes in Arabidopsis.
    Plant Cell, 2013. 25(3): p. 927-43
    [PMID:23482857]
  28. Vaistij FE, et al.
    Differential control of seed primary dormancy in Arabidopsis ecotypes by the transcription factor SPATULA.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(26): p. 10866-71
    [PMID:23754415]
  29. Sarnowska EA, et al.
    DELLA-interacting SWI3C core subunit of switch/sucrose nonfermenting chromatin remodeling complex modulates gibberellin responses and hormonal cross talk in Arabidopsis.
    Plant Physiol., 2013. 163(1): p. 305-17
    [PMID:23893173]
  30. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]
  31. Bai S, et al.
    PIF3 is involved in the primary root growth inhibition of Arabidopsis induced by nitric oxide in the light.
    Mol Plant, 2014. 7(4): p. 616-25
    [PMID:24157606]
  32. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  33. Davi
    Class I TCP-DELLA interactions in inflorescence shoot apex determine plant height.
    Curr. Biol., 2014. 24(16): p. 1923-8
    [PMID:25127215]
  34. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]