PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G17490.1
Common NameAtRGL3, K3M16.60, RGL3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 523aa    MW: 57326.7 Da    PI: 4.4947
Description RGA-like protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G17490.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4332.3e-1321575161374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv++L++cAeav+ ++l+la+al++r+  la++++ +m ++a+yf+eALa+r++r        ++ps+++ + s ee+     f++ +P+lkf+h+ta
  AT5G17490.1 157 LVQALVACAEAVQLENLSLADALVKRVGLLAASQAGAMGKVATYFAEALARRIYR--------IHPSAAAIDPSFEEILQ-MNFYDSCPYLKFAHFTA 245
                  689****************************************************........55555554445555444.46*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIleav +++ vH+iD++++qG+QWpaL+qaLa Rp+gpps+R+Tgvg+p+  ++e ++e+g++La++A+++gv+f+fn l+++rl+dle++++++
  AT5G17490.1 246 NQAILEAVTTSRVVHVIDLGLNQGMQWPALMQALALRPGGPPSFRLTGVGNPS--NREGIQELGWKLAQLAQAIGVEFKFNGLTTERLSDLEPDMFET 341
                  ***************************************************88..9****************************************** PP

         GRAS 197 kp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++  E+l+Vn+v++lh +l++++s+e+    +L +vk ++P +v+vveqea+hn+  Fl+rf eal+yys+lfdsle ++   s++r+ +++++lgr+
  AT5G17490.1 342 RTeSETLVVNSVFELHPVLSQPGSIEK----LLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLEDGVVIPSQDRV-MSEVYLGRQ 434
                  *99************************....************************************************988888776.56677**** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  i n+va+eg++r+erhetl++Wr+r+++aGF pv+l+++a kqa+lll+  + +dgyrvee++gsl+l W+++pL+++SaW+
  AT5G17490.1 435 ILNLVATEGSDRIERHETLAQWRKRMGSAGFDPVNLGSDAFKQASLLLALSGgGDGYRVEENDGSLMLAWQTKPLIAASAWK 516
                  *********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.1E-3234100IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.0E-4134106No hitNo description
PROSITE profilePS5098564.222131495IPR005202Transcription factor GRAS
PfamPF035148.1E-130157516IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process