PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G17300.1
Common NameMKP11.15, RVE1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 387aa    MW: 42980.9 Da    PI: 8.216
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G17300.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-165599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT eE++++v+a k++G   W++I +++g  +t+ q++s+ qk+
      AT5G17300.1 55 RERWTDEEHKKFVEALKLYGRA-WRRIEEHVG-SKTAVQIRSHAQKF 99
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.57E-1649104IPR009057Homeodomain-like
PROSITE profilePS5129419.90850104IPR017930Myb domain
TIGRFAMsTIGR015571.3E-1653102IPR006447Myb domain, plants
SMARTSM007178.0E-1354102IPR001005SANT/Myb domain
PfamPF002493.7E-135598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-95595IPR009057Homeodomain-like
CDDcd001676.40E-1057100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000016anatomylateral root primordium
PO:0000025anatomyroot tip
PO:0000037anatomyshoot apex
PO:0000039anatomyshoot axis vascular system
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0005660anatomyhydathode
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020003anatomyplant ovule
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0020149anatomyquiescent center
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSPLTANV QGTNASLRNR DEETADKQIQ FNDQSFGGND YAPKVRKPYT ITKERERWTD  60
EEHKKFVEAL KLYGRAWRRI EEHVGSKTAV QIRSHAQKFF SKVAREATGG DGSSVEPIVI  120
PPPRPKRKPA HPYPRKFGNE ADQTSRSVSP SERDTQSPTS VLSTVGSEAL CSLDSSSPNR  180
SLSPVSSASP PAALTTTANA PEELETLKLE LFPSERLLNR ESSIKEPTKQ SLKLFGKTVL  240
VSDSGMSSSL TTSTYCKSPI QPLPRKLSSS KTLPIIRNSQ EELLSCWIQV PLKQEDVENR  300
CLDSGKAVQN EGSSTGSNTG SVDDTGHTEK TTEPETMLCQ WEFKPSERSA FSELRRTNSE  360
SNSRGFGPYK KRKMVTEEEE HEIHLHL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.217180.0bud| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425679110.0
Genevisible250099_at0.0
Expression AtlasAT5G17300-
AtGenExpressAT5G17300-
ATTED-IIAT5G17300-
Functional Description ? help Back to Top
Source Description
TAIRMyb-like transcription factor that regulates hypocotyl growth by regulating free auxin levels in a time-of-day specific manner.
UniProtMorning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Function -- GeneRIF ? help Back to Top
  1. Authors have characterized REVEILLE1 (RVE1), a Myb-like, clock-regulated transcription factor that is homologous to the central clock genes CIRCADIAN CLOCK ASSOCIATED 1 (CCA1) and LATE ELONGATED HYPOCOTYL (LHY). [RVE1]
    [PMID: 19805390]
  2. Reveille1 is identified as a novel negative regulator of freezing tolerance in Arabidopsis.
    [PMID: 23240770]
  3. our study reveals an important role for RVE1 in regulating chlorophyll biosynthesis and promoting seedling greening during early plant growth and development.
    [PMID: 25910753]
  4. RVE1 directly binds to the promoter of GIBBERELLIN 3-OXIDASE 2, inhibits its transcription and thus suppresses the biosynthesis of bioactive gibberellins.
    [PMID: 27506149]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G17300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G28720(A)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No effect on the regulation of core clock associated genes, but shorter hypocotyl length and higher freezing tolerance. Rve1 and rve2 double mutant has no alteration in the period or phase of the clock. Rve1, rve2 and rve7 triple mutant has no alteration in the period or phase of the clock. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G17300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3788600.0AF378860.1 Arabidopsis thaliana AT5g17300/MKP11_15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568344.20.0Homeodomain-like superfamily protein
SwissprotF4KGY60.0RVE1_ARATH; Protein REVEILLE 1
TrEMBLA0A178UEX60.0A0A178UEX6_ARATH; RVE1
STRINGAT5G17300.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63562644
Representative plantOGRP12551549
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Mizoguchi T, et al.
    LHY and CCA1 are partially redundant genes required to maintain circadian rhythms in Arabidopsis.
    Dev. Cell, 2002. 2(5): p. 629-41
    [PMID:12015970]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Branco-Price C,Kawaguchi R,Ferreira RB,Bailey-Serres J
    Genome-wide analysis of transcript abundance and translation in Arabidopsis seedlings subjected to oxygen deprivation.
    Ann. Bot., 2005. 96(4): p. 647-60
    [PMID:16081496]
  5. Suzuki N, et al.
    Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c.
    Plant Physiol., 2005. 139(3): p. 1313-22
    [PMID:16244138]
  6. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  7. Usadel B, et al.
    Global transcript levels respond to small changes of the carbon status during progressive exhaustion of carbohydrates in Arabidopsis rosettes.
    Plant Physiol., 2008. 146(4): p. 1834-61
    [PMID:18305208]
  8. Skinner DJ,Gasser CS
    Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants.
    BMC Plant Biol., 2009. 9: p. 29
    [PMID:19291320]
  9. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  10. Causier B,Ashworth M,Guo W,Davies B
    The TOPLESS interactome: a framework for gene repression in Arabidopsis.
    Plant Physiol., 2012. 158(1): p. 423-38
    [PMID:22065421]
  11. Meissner M, et al.
    Mapping quantitative trait loci for freezing tolerance in a recombinant inbred line population of Arabidopsis thaliana accessions Tenela and C24 reveals REVEILLE1 as negative regulator of cold acclimation.
    Plant Cell Environ., 2013. 36(7): p. 1256-67
    [PMID:23240770]
  12. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  13. Xu G, et al.
    REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
    Photosyn. Res., 2015. 126(2-3): p. 331-40
    [PMID:25910753]
  14. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]