PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G17260.1
Common Nameanac086, MKP11.11, NAC086
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 476aa    MW: 54828.9 Da    PI: 5.2261
Description NAC domain containing protein 86
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G17260.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.86.2e-5561331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeel+++yLk+k++g+++el e+i+evd+yk+ePwdLp k  + ++++ew+fFs+rd+ky++g+r+nratk gyWkatgkd++v   +
  AT5G17260.1   6 LPPGFRFHPTDEELITYYLKRKINGQEIEL-EIIPEVDLYKCEPWDLPgKsLIPSKDQEWFFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSW-R 101
                  79****************************.99***************6346677999*************************************9.8 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLv+y+grap+g +t Wvmheyrl
  AT5G17260.1 102 DRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                  899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-634157IPR003441NAC domain
PROSITE profilePS5100560.8816157IPR003441NAC domain
PfamPF023655.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0090602Biological Processsieve element enucleation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING QEIELEIIPE VDLYKCEPWD LPGKSLIPSK  60
DQEWFFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDESECEP SAFGMQDAYA LCRVFKKIVI EAKPRDQHQQ QHQPYVHTSS  180
NISGSSSFDV CSDLEISSNT PYNTAAHIQP RFGNANAISD HDDWSQYLSQ NMPTSFSDYG  240
SPYGPYLTQS KVNTEVQCEM FQHQMSLPPL RVENSQAQTS DFSKRLHQNS GQSGFDDFTF  300
AASNSNQFYN SNVDDHLIHI GNLDEQSYIE EQELILPSFQ SNDQDLELYG GSRTNTIDNI  360
EIDDFFSFEN QAQDNDNSNV TPNSAGFEMI GEEIIVNHKM LISTRQTTEI LYYQVVPSQI  420
LKIHINPVHG NEERTMLMEE DSDDSWFQKA ENVAKMKLKQ ISLVAKRYYK CLTIIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-54215711168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.507090.0floral meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184182360.0
Genevisible250086_at0.0
Expression AtlasAT5G17260-
AtGenExpressAT5G17260-
ATTED-IIAT5G17260-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Function -- GeneRIF ? help Back to Top
  1. NAC45/86 orchestrate the enucleation, perinuclear organelle clustering, shift in NEN1 and NEN2 localization, and cytosol degradation by regulating the expression of a set of target genes, including NEN1, NEN2, and NEN4.
    [PMID: 25081480]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G17260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: No visible phenotype, due to the redundancy with NAC045 (AC A4VCM0). Nac045 and nac086 double mutants exhibit seedling lethality with defective development of the protophloem sieve element. {ECO:0000269|PubMed:25081480}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G17260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAB0052380.0AB005238.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKP11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197228.10.0NAC domain containing protein 86
SwissprotQ9FFI50.0NAC86_ARATH; NAC domain-containing protein 86
TrEMBLD7LWY70.0D7LWY7_ARALL; ANAC086 (Fragment)
STRINGAT5G17260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Furuta KM, et al.
    Plant development. Arabidopsis NAC45/86 direct sieve element morphogenesis culminating in enucleation.
    Science, 2014. 345(6199): p. 933-7
    [PMID:25081480]