PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G15830.1
Common NameAtbZIP3, bZIP3, F14F8_210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 186aa    MW: 21656.7 Da    PI: 5.0497
Description basic leucine-zipper 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G15830.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.57.7e-1574124555
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  +++rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++L ++l++ +++
  AT5G15830.1  74 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVSDN 124
                  689*******************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1370134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.81872135IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-1173125No hitNo description
PfamPF001701.0E-1274125IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.94E-1374124No hitNo description
CDDcd147025.27E-1875122No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009046anatomyflower
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MQPNYDSSSL NNMQQQDYFN LNNYYNNLNP STNNNNLNIL QYPQIQELNL QSPVSNNSTT  60
SDDATEEIFV INERKQRRMV SNRESARRSR MRKQRHLDEL LSQVAWLRSE NHQLLDKLNQ  120
VSDNNDLVIQ ENSSLKEENL ELRQVITSMK KLGGGIHDKY SSPSSMDELD QDFSSITDDP  180
RTHHPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18693RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.317470.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO264507210.0
Genevisible246522_at0.0
Expression AtlasAT5G15830-
AtGenExpressAT5G15830-
ATTED-IIAT5G15830-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00512DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G15830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G15830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankBT0036830.0BT003683.1 Arabidopsis thaliana At5g15830 mRNA, complete cds.
GenBankAL3911440.0AL391144.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F14F8 (ESSA project).
GenBankAK1178280.0AK117828.1 Arabidopsis thaliana At5g15830 mRNA for putative bZIP transcription factor AtbZip3, complete cds, clone: RAFL18-02-O03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197087.11e-132basic leucine-zipper 3
SwissprotQ9FMC23e-33BZP43_ARATH; Basic leucine zipper 43
TrEMBLQ9LFU31e-132Q9LFU3_ARATH; At5g15830
STRINGAT5G15830.11e-132(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Representative plantOGRP31041129
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  4. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  5. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  6. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  7. Che P,Lall S,Nettleton D,Howell SH
    Gene expression programs during shoot, root, and callus development in Arabidopsis tissue culture.
    Plant Physiol., 2006. 141(2): p. 620-37
    [PMID:16648215]
  8. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  9. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  10. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  11. Kuhn JM,Breton G,Schroeder JI
    mRNA metabolism of flowering-time regulators in wild-type Arabidopsis revealed by a nuclear cap binding protein mutant, abh1.
    Plant J., 2007. 50(6): p. 1049-62
    [PMID:17488241]
  12. Matiolli CC, et al.
    The Arabidopsis bZIP gene AtbZIP63 is a sensitive integrator of transient abscisic acid and glucose signals.
    Plant Physiol., 2011. 157(2): p. 692-705
    [PMID:21844310]
  13. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]