PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G15800.1
Common NameAGL2, F14F8_180, SEP1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28656.6 Da    PI: 8.6585
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G15800.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  AT5G15800.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                 79***********************************************96 PP

2K-box97.52.1e-3278173499
        K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                   + +++ +++ e++++e+ kLk ++enLqr+qR+llGedL++L+ keL+qLe+qL+ slk++Rs K++++l+q+++lq+ke++l e+n+aL +kl+
  AT5G15800.1  78 IEVNNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRSIKTQYMLDQLSDLQNKEQMLLETNRALAMKLD 173
                  56667788999*********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002653.01E-45277No hitNo description
SuperFamilySSF554553.53E-34280IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014869.3E-2685172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.88988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SNMLKTLDRY QKCSYGSIEV NNKPAKELEN SYREYLKLKG RYENLQRQQR NLLGEDLGPL  120
NSKELEQLER QLDGSLKQVR SIKTQYMLDQ LSDLQNKEQM LLETNRALAM KLDDMIGVRS  180
HHMGGGGGWE GGEQNVTYAH HQAQSQGLYQ PLECNPTLQM GYDNPVCSEQ ITATTQAQAQ  240
QGNGYIPGWM L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-34751741103Developmental protein SEPALLATA 3
4ox0_B2e-34751741103Developmental protein SEPALLATA 3
4ox0_C2e-34751741103Developmental protein SEPALLATA 3
4ox0_D2e-34751741103Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.101630.0floral meristem| flower| inflorescence| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246531_at0.0
Expression AtlasAT5G15800-
AtGenExpressAT5G15800-
ATTED-IIAT5G15800-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed early during flower development.
UniprotTISSUE SPECIFICITY: Expressed mainly in carpels, and weakly in stamens.
Functional Description ? help Back to Top
Source Description
TAIREncodes a MADS box transcription factor involved flower and ovule development. Functionally redundant with SEP2 and SEP3.
UniProtProbable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00092SELEX26531826Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G15800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G69120AP1 interacts with SEP1.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G15800, AT5G20240, AT5G23260, AT5G51870, AT5G60910, AT5G62165, AT1G69120, AT1G71692
IntActSearch P29382
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Triple mutations in the SEP1, SEP2 and SEP3 genes result in the replacement of the stamens and petals by sepals and of the carpels by a new mutant flower with sepaloid organs. {ECO:0000269|PubMed:10821278}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G15800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0062240.0BT006224.1 Arabidopsis thaliana At5g15800 gene, complete cds.
GenBankAK1186080.0AK118608.1 Arabidopsis thaliana At5g15800 mRNA for putative transcription factor (AGL2), complete cds, clone: RAFL19-86-A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568322.10.0MADS box transcription factor SEPALLATA 1
SwissprotP293820.0SEP1_ARATH; Developmental protein SEPALLATA 1
TrEMBLQ5XXN80.0Q5XXN8_ARATH; SEPALLATA1
STRINGscaffold_601612.11e-174(Arabidopsis lyrata)
Publications ? help Back to Top
  1. Sung SK,Yu GH,Nam J,Jeong DH,An G
    Developmentally regulated expression of two MADS-box genes, MdMADS3 and MdMADS4, in the morphogenesis of flower buds and fruits in apple.
    Planta, 2000. 210(4): p. 519-28
    [PMID:10787044]
  2. Pelaz S,Ditta GS,Baumann E,Wisman E,Yanofsky MF
    B and C floral organ identity functions require SEPALLATA MADS-box genes.
    Nature, 2000. 405(6783): p. 200-3
    [PMID:10821278]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Pelaz S,Gustafson-Brown C,Kohalmi SE,Crosby WL,Yanofsky MF
    APETALA1 and SEPALLATA3 interact to promote flower development.
    Plant J., 2001. 26(4): p. 385-94
    [PMID:11439126]
  5. Li J,Jia D,Chen X
    HUA1, a regulator of stamen and carpel identities in Arabidopsis, codes for a nuclear RNA binding protein.
    Plant Cell, 2001. 13(10): p. 2269-81
    [PMID:11595801]
  6. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  7. Ampomah-Dwamena C,Morris BA,Sutherland P,Veit B,Yao JL
    Down-regulation of TM29, a tomato SEPALLATA homolog, causes parthenocarpic fruit development and floral reversion.
    Plant Physiol., 2002. 130(2): p. 605-17
    [PMID:12376628]
  8. Favaro R, et al.
    Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants.
    Mol. Genet. Genomics, 2002. 268(2): p. 152-9
    [PMID:12395189]
  9. Ferrario S,Immink RG,Shchennikova A,Busscher-Lange J,Angenent GC
    The MADS box gene FBP2 is required for SEPALLATA function in petunia.
    Plant Cell, 2003. 15(4): p. 914-25
    [PMID:12671087]
  10. Alvarez-Venegas R, et al.
    ATX-1, an Arabidopsis homolog of trithorax, activates flower homeotic genes.
    Curr. Biol., 2003. 13(8): p. 627-37
    [PMID:12699618]
  11. Yan L, et al.
    Positional cloning of the wheat vernalization gene VRN1.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(10): p. 6263-8
    [PMID:12730378]
  12. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  13. Yang Y,Xiang H,Jack T
    pistillata-5, an Arabidopsis B class mutant with strong defects in petal but not in stamen development.
    Plant J., 2003. 33(1): p. 177-88
    [PMID:12943551]
  14. Favaro R, et al.
    MADS-box protein complexes control carpel and ovule development in Arabidopsis.
    Plant Cell, 2003. 15(11): p. 2603-11
    [PMID:14555696]
  15. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  16. Becker A,Theissen G
    The major clades of MADS-box genes and their role in the development and evolution of flowering plants.
    Mol. Phylogenet. Evol., 2003. 29(3): p. 464-89
    [PMID:14615187]
  17. Fornara F, et al.
    Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes.
    Plant Physiol., 2004. 135(4): p. 2207-19
    [PMID:15299121]
  18. Moore RC,Grant SR,Purugganan MD
    Molecular population genetics of redundant floral-regulatory genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2005. 22(1): p. 91-103
    [PMID:15371526]
  19. Ditta G,Pinyopich A,Robles P,Pelaz S,Yanofsky MF
    The SEP4 gene of Arabidopsis thaliana functions in floral organ and meristem identity.
    Curr. Biol., 2004. 14(21): p. 1935-40
    [PMID:15530395]
  20. Yang Y,Jack T
    Defining subdomains of the K domain important for protein-protein interactions of plant MADS proteins.
    Plant Mol. Biol., 2004. 55(1): p. 45-59
    [PMID:15604664]
  21. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  22. Kaufmann K,Anfang N,Saedler H,Theissen G
    Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein.
    Mol. Genet. Genomics, 2005. 274(2): p. 103-18
    [PMID:16080001]
  23. Malcomber ST,Kellogg EA
    SEPALLATA gene diversification: brave new whorls.
    Trends Plant Sci., 2005. 10(9): p. 427-35
    [PMID:16099195]
  24. Agrawal GK,Abe K,Yamazaki M,Miyao A,Hirochika H
    Conservation of the E-function for floral organ identity in rice revealed by the analysis of tissue culture-induced loss-of-function mutants of the OsMADS1 gene.
    Plant Mol. Biol., 2005. 59(1): p. 125-35
    [PMID:16217607]
  25. Ma H,Yanofsky MF,Meyerowitz EM
    AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes.
    Genes Dev., 1991. 5(3): p. 484-95
    [PMID:1672119]
  26. Fan J,Li W,Dong X,Guo W,Shu H
    Ectopic expression of a hyacinth AGL6 homolog caused earlier flowering and homeotic conversion in Arabidopsis.
    Sci. China, C, Life Sci., 2007. 50(5): p. 676-89
    [PMID:17879068]
  27. Huang F,Chi Y,Gai J,Yu D
    Identification of transcription factors predominantly expressed in soybean flowers and characterization of GmSEP1 encoding a SEPALLATA1-like protein.
    Gene, 2009. 438(1-2): p. 40-8
    [PMID:19289160]
  28. Chang YY,Chiu YF,Wu JW,Yang CH
    Four orchid (Oncidium Gower Ramsey) AP1/AGL9-like MADS box genes show novel expression patterns and cause different effects on floral transition and formation in Arabidopsis thaliana.
    Plant Cell Physiol., 2009. 50(8): p. 1425-38
    [PMID:19541596]
  29. Matias-Hernandez L, et al.
    VERDANDI is a direct target of the MADS domain ovule identity complex and affects embryo sac differentiation in Arabidopsis.
    Plant Cell, 2010. 22(6): p. 1702-15
    [PMID:20581305]
  30. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  31. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  32. Li G, et al.
    Imitation Switch chromatin remodeling factors and their interacting RINGLET proteins act together in controlling the plant vegetative phase in Arabidopsis.
    Plant J., 2012. 72(2): p. 261-70
    [PMID:22694359]
  33. Jetha K,Thei
    Arabidopsis SEPALLATA proteins differ in cooperative DNA-binding during the formation of floral quartet-like complexes.
    Nucleic Acids Res., 2014. 42(17): p. 10927-42
    [PMID:25183521]
  34. Tandre K,Albert VA,Sund
    Conifer homologues to genes that control floral development in angiosperms.
    Plant Mol. Biol., 1995. 27(1): p. 69-78
    [PMID:7865797]
  35. Flanagan CA,Ma H
    Spatially and temporally regulated expression of the MADS-box gene AGL2 in wild-type and mutant arabidopsis flowers.
    Plant Mol. Biol., 1994. 26(2): p. 581-95
    [PMID:7948914]
  36. Huang H, et al.
    DNA binding properties of two Arabidopsis MADS domain proteins: binding consensus and dimer formation.
    Plant Cell, 1996. 8(1): p. 81-94
    [PMID:8597661]
  37. Greco R, et al.
    MADS box genes expressed in developing inflorescences of rice and sorghum.
    Mol. Gen. Genet., 1997. 253(5): p. 615-23
    [PMID:9065695]
  38. Fan HY,Hu Y,Tudor M,Ma H
    Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins.
    Plant J., 1997. 12(5): p. 999-1010
    [PMID:9418042]
  39. Mouradov A, et al.
    Family of MADS-Box genes expressed early in male and female reproductive structures of monterey pine
    Plant Physiol., 1998. 117(1): p. 55-62
    [PMID:9576774]
  40. Chung YY,Lee KJ,An G
    Characterization of a tobacco MADS-box gene homologous to AGL2.
    Mol. Cells, 1998. 8(6): p. 764-9
    [PMID:9895132]