PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G15150.1
Common NameATHB3, ATHB-3, F8M21_40, HAT7, HB-3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 314aa    MW: 36282.1 Da    PI: 6.8667
Description homeobox 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G15150.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.1e-18116168456
                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  AT5G15150.1 116 KKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 168
                  4568889*********************************************9 PP

2HD-ZIP_I/II128.43.1e-41114205192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekk+rl+ eqv++LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dy++Lk+++d lk++n++L +++++L++el 
  AT5G15150.1 114 EKKKRLNLEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSDNDSLLAHNKKLHAELV 205
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.29E-19106172IPR009057Homeodomain-like
SMARTSM003892.6E-17113174IPR001356Homeobox domain
PROSITE profilePS5007116.552114170IPR001356Homeobox domain
CDDcd000862.00E-16115171No hitNo description
PfamPF000463.3E-15116168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-19118178IPR009057Homeodomain-like
PRINTSPR000311.2E-5141150IPR000047Helix-turn-helix motif
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5150166IPR000047Helix-turn-helix motif
PfamPF021834.6E-15170209IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000223anatomyshoot axis cortex
PO:0000258anatomyroot cortex
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025257anatomyprimary root elongation zone
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYMYEEERNN INNNQEGLRL EMAFPQHGFM FQQLHEDNAH HLPSPTSLPS CPPHLFYGGG  60
GNYMMNRSMS FTGVSDHHHL TQKSPTTTNN MNDQDQVGEE DNLSDDGSHM MLGEKKKRLN  120
LEQVRALEKS FELGNKLEPE RKMQLAKALG LQPRQIAIWF QNRRARWKTK QLERDYDSLK  180
KQFDVLKSDN DSLLAHNKKL HAELVALKKH DRKESAKIKR EFAEASWSNN GSTENNHNNN  240
SSDANHVSMI KDLFPSSIRS ATATTTSTHI DHQIVQDQDQ GFCNMFNGID ETTSASYWAW  300
PDQQQQHHNH HQFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.490220.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250108_at0.0
Expression AtlasAT5G15150-
AtGenExpressAT5G15150-
ATTED-IIAT5G15150-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in flowers, and in the cortex of the root and the stem. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
TAIRhomeobox-containing gene with an unusual feature: a leucine zipper motif adjacent to the carboxyl-terminal of the homeodomain structure. This gene is expressed primarily in the cortex of the root and the stem.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G15150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G15150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293640.0AK229364.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL16-61-C06.
GenBankBT0440590.0BT044059.1 Arabidopsis thaliana unknown protein (At5g15150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568309.20.0homeobox 3
SwissprotQ004660.0HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLB5RID50.0B5RID5_ARATH; At5g15150
STRINGAT5G15150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30952666
Representative plantOGRP12916189
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Johannesson H,Wang Y,Engström P
    DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro.
    Plant Mol. Biol., 2001. 45(1): p. 63-73
    [PMID:11247607]
  3. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  4. Mattsson J,S
    A new homeobox-leucine zipper gene from Arabidopsis thaliana.
    Plant Mol. Biol., 1992. 18(5): p. 1019-22
    [PMID:1349836]
  5. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  6. Oh S,Park S,Han KH
    Transcriptional regulation of secondary growth in Arabidopsis thaliana.
    J. Exp. Bot., 2003. 54(393): p. 2709-22
    [PMID:14585825]
  7. Henriksson E, et al.
    Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships.
    Plant Physiol., 2005. 139(1): p. 509-18
    [PMID:16055682]
  8. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  9. Saddic LA, et al.
    The LEAFY target LMI1 is a meristem identity regulator and acts together with LEAFY to regulate expression of CAULIFLOWER.
    Development, 2006. 133(9): p. 1673-82
    [PMID:16554366]
  10. Roig-Villanova I,Bou J,Sorin C,Devlin PF,Martínez-García JF
    Identification of primary target genes of phytochrome signaling. Early transcriptional control during shade avoidance responses in Arabidopsis.
    Plant Physiol., 2006. 141(1): p. 85-96
    [PMID:16565297]
  11. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  12. Mace DL, et al.
    Quantification of transcription factor expression from Arabidopsis images.
    Bioinformatics, 2006. 22(14): p. e323-31
    [PMID:16873489]
  13. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  14. Tahir M,Belmonte MF,Elhiti M,Flood H,Stasolla C
    Identification and characterization of PgHZ1, a novel homeodomain leucine-zipper gene isolated from white spruce (Picea glauca) tissue.
    Plant Physiol. Biochem., 2008. 46(12): p. 1031-9
    [PMID:18848454]
  15. Schena M,Davis RW
    Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7
    [PMID:7915839]
  16. S
    Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana.
    Plant Mol. Biol., 1994. 26(1): p. 145-54
    [PMID:7948864]