PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G14750.1
Common NameATMYB66, MYB66, T9L3.50, WER, WER1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 203aa    MW: 23568.6 Da    PI: 8.7778
Description myb domain protein 66
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G14750.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-191865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l d+vk +G+g+W++Ia++ g++R++k+c++rw +yl
      AT5G14750.1 18 KGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYL 65
                     678*******************************************97 PP

2Myb_DNA-binding61.61.7e-1971116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
      AT5G14750.1  71 RGNFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 116
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.951365IPR017930Myb domain
SuperFamilySSF466891.26E-3116112IPR009057Homeodomain-like
SMARTSM007172.6E-151767IPR001005SANT/Myb domain
PfamPF002495.0E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-251972IPR009057Homeodomain-like
CDDcd001671.10E-112165No hitNo description
PROSITE profilePS5129428.73766120IPR017930Myb domain
SMARTSM007175.6E-1970118IPR001005SANT/Myb domain
PfamPF002491.8E-1871116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2773120IPR009057Homeodomain-like
CDDcd001672.39E-1373116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0045165Biological Processcell fate commitment
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000026anatomyprimary root tip
PO:0000061anatomylateral root-cap epidermal initial cell
PO:0000084anatomyplant sperm cell
PO:0000263anatomynon-hair root epidermal cell
PO:0003018anatomyroot cap of lateral root
PO:0003021anatomycentral root cap of primary root
PO:0006036anatomyroot epidermis
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MRKKVSSSGD EGNNEYKKGL WTVEEDKILM DYVKAHGKGH WNRIAKKTGL KRCGKSCRLR  60
WMNYLSPNVK RGNFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN YWNTHLSKKL  120
GIKDQKTKQS NGDIVYQINL PNPTETSEET KISNIVDNNN ILGDEIQEDH QGSNYLSSLW  180
VHEDEFELST LTNMMDFIDG HCF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29181207108B-MYB
1h8a_C2e-291312022128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.286800.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306850330.0
Genevisible246585_at0.0
Expression AtlasAT5G14750-
AtGenExpressAT5G14750-
ATTED-IIAT5G14750-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a MyB-related protein containing R2 and R3 repeats, involved in root and hypocotyl epidermal cell fate determination. Loss of function mutations make extra root hairs. Nuclear localized protein is a positive regulator for expression of CAPRICE (CPC).
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}.
Function -- GeneRIF ? help Back to Top
  1. The functional relationship of the R2R3-type MYB gene WEREWOLF (WER) and the R3-type MYB gene CAPRICE (CPC), was analyzed.
    [PMID: 17644729]
  2. WER regulates not the transcription but the stability of FT mRNA.
    [PMID: 21653190]
  3. WER and CPC compete with one another to define cell fates in the Arabidopsis root epidermis.
    [PMID: 21914815]
  4. MYB23, WER, and MYB23-WER chimeric protein have similar functions in respect to root hair formation.
    [PMID: 22738953]
  5. Phosphatidic acid interacts with werewolf (WER), a R2R3 MYB transcription factor involved in root hair formation.
    [PMID: 24368785]
  6. Double mutant analysis reveal that wer and caprice (cpc) mutants, defective in core components of the epidermal patterning pathway, genetically interact with sab. This suggests that SAB may act on epidermal patterning upstream of WER and CPC.
    [PMID: 25124848]
  7. AIP1-2, expressed under control of the WER-dependent patterning machinery and the ethylene signalling pathway, as a modulator of actin-mediated planar polarity.
    [PMID: 25428588]
  8. WER expressed ubiquitously in the root induced GL2 expression only in the root epidermis, whereas co-expression of WER and EGL3 induced GL2 expression in the corresponding tissues.
    [PMID: 26408906]
  9. TRN1 regulates the position-dependent cell fate determination by affecting WER expression in Arabidopsis root epidermis.
    [PMID: 26451798]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G14750.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G79840 (R), AT2G46410 (R)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G01380(A), AT1G79840(A), AT2G37260(A), AT2G46410(A), AT4G01060(A), AT5G40330(A), AT5G53200(A)
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G63650EGL3 interacts with WER.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G41315, AT1G63650
IntActSearch Q9SEI0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G14750
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196230.0AY519623.1 Arabidopsis thaliana MYB transcription factor (At5g14750) mRNA, complete cds.
GenBankBT0263460.0BT026346.1 Arabidopsis thaliana At5g14750 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196979.11e-150myb domain protein 66
SwissprotQ9SEI01e-151WER_ARATH; Transcription factor WER
TrEMBLA0A384KIP71e-149A0A384KIP7_ARATH; WER1
TrEMBLC0SVP61e-149C0SVP6_ARATH; Uncharacterized protein At5g14750 (Fragment)
STRINGAT5G14750.11e-149(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Lee MM,Schiefelbein J
    WEREWOLF, a MYB-related protein in Arabidopsis, is a position-dependent regulator of epidermal cell patterning.
    Cell, 1999. 99(5): p. 473-83
    [PMID:10589676]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Lin Y,Schiefelbein J
    Embryonic control of epidermal cell patterning in the root and hypocotyl of Arabidopsis.
    Development, 2001. 128(19): p. 3697-705
    [PMID:11585796]
  4. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  5. Lee MM,Schiefelbein J
    Cell pattern in the Arabidopsis root epidermis determined by lateral inhibition with feedback.
    Plant Cell, 2002. 14(3): p. 611-8
    [PMID:11910008]
  6. Cho HT,Cosgrove DJ
    Regulation of root hair initiation and expansin gene expression in Arabidopsis.
    Plant Cell, 2002. 14(12): p. 3237-53
    [PMID:12468740]
  7. Costa S,Dolan L
    Epidermal patterning genes are active during embryogenesis in Arabidopsis.
    Development, 2003. 130(13): p. 2893-901
    [PMID:12756173]
  8. Bernhardt C, et al.
    The bHLH genes GLABRA3 (GL3) and ENHANCER OF GLABRA3 (EGL3) specify epidermal cell fate in the Arabidopsis root.
    Development, 2003. 130(26): p. 6431-9
    [PMID:14627722]
  9. Serna L
    A network of interacting factors triggering different cell fates.
    Plant Cell, 2004. 16(9): p. 2258-63
    [PMID:15342905]
  10. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  11. Montiel G,Gantet P,Jay-Allemand C,Breton C
    Transcription factor networks. Pathways to the knowledge of root development.
    Plant Physiol., 2004. 136(3): p. 3478-85
    [PMID:15542499]
  12. Koshino-Kimura Y, et al.
    Regulation of CAPRICE transcription by MYB proteins for root epidermis differentiation in Arabidopsis.
    Plant Cell Physiol., 2005. 46(6): p. 817-26
    [PMID:15795220]
  13. Xu CR, et al.
    Histone acetylation affects expression of cellular patterning genes in the Arabidopsis root epidermis.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(40): p. 14469-74
    [PMID:16176989]
  14. Ryu KH, et al.
    The WEREWOLF MYB protein directly regulates CAPRICE transcription during cell fate specification in the Arabidopsis root epidermis.
    Development, 2005. 132(21): p. 4765-75
    [PMID:16207757]
  15. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  16. Lee JY, et al.
    Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
    [PMID:16581911]
  17. Molas ML,Kiss JZ,Correll MJ
    Gene profiling of the red light signalling pathways in roots.
    J. Exp. Bot., 2006. 57(12): p. 3217-29
    [PMID:16908503]
  18. Kwak SH,Schiefelbein J
    The role of the SCRAMBLED receptor-like kinase in patterning the Arabidopsis root epidermis.
    Dev. Biol., 2007. 302(1): p. 118-31
    [PMID:17027738]
  19. Tominaga R,Iwata M,Okada K,Wada T
    Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2264-77
    [PMID:17644729]
  20. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  21. Wang S, et al.
    Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis.
    BMC Plant Biol., 2008. 8: p. 81
    [PMID:18644155]
  22. Savage NS, et al.
    A mutual support mechanism through intercellular movement of CAPRICE and GLABRA3 can pattern the Arabidopsis root epidermis.
    PLoS Biol., 2008. 6(9): p. e235
    [PMID:18816165]
  23. Kwak SH,Schiefelbein J
    A feedback mechanism controlling SCRAMBLED receptor accumulation and cell-type pattern in Arabidopsis.
    Curr. Biol., 2008. 18(24): p. 1949-54
    [PMID:19097902]
  24. Kang YH, et al.
    The MYB23 gene provides a positive feedback loop for cell fate specification in the Arabidopsis root epidermis.
    Plant Cell, 2009. 21(4): p. 1080-94
    [PMID:19395683]
  25. Kuppusamy KT,Chen AY,Nemhauser JL
    Steroids are required for epidermal cell fate establishment in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(19): p. 8073-6
    [PMID:19416891]
  26. Tominaga-Wada R, et al.
    The GLABRA2 homeodomain protein directly regulates CESA5 and XTH17 gene expression in Arabidopsis roots.
    Plant J., 2009. 60(3): p. 564-74
    [PMID:19619157]
  27. Kwak SH,Schiefelbein J
    Cellular pattern formation by SCRAMBLED, a leucine-rich repeat receptor-like kinase in Arabidopsis.
    Plant Signal Behav, 2008. 3(2): p. 110-2
    [PMID:19704725]
  28. Hassan H,Scheres B,Blilou I
    JACKDAW controls epidermal patterning in the Arabidopsis root meristem through a non-cell-autonomous mechanism.
    Development, 2010. 137(9): p. 1523-9
    [PMID:20356954]
  29. Niu Y, et al.
    Auxin modulates the enhanced development of root hairs in Arabidopsis thaliana (L.) Heynh. under elevated CO(2).
    Plant Cell Environ., 2011. 34(8): p. 1304-17
    [PMID:21477123]
  30. Seo E,Yu J,Ryu KH,Lee MM,Lee I
    WEREWOLF, a regulator of root hair pattern formation, controls flowering time through the regulation of FT mRNA stability.
    Plant Physiol., 2011. 156(4): p. 1867-77
    [PMID:21653190]
  31. Song SK, et al.
    Cell fate in the Arabidopsis root epidermis is determined by competition between WEREWOLF and CAPRICE.
    Plant Physiol., 2011. 157(3): p. 1196-208
    [PMID:21914815]
  32. Tominaga-Wada R,Nukumizu Y,Wada T
    Amino acid substitution converts WEREWOLF function from an activator to a repressor of Arabidopsis non-hair cell development.
    Plant Sci., 2012. 183: p. 37-42
    [PMID:22195575]
  33. Zhao H, et al.
    A single amino acid substitution in IIIf subfamily of basic helix-loop-helix transcription factor AtMYC1 leads to trichome and root hair patterning defects by abolishing its interaction with partner proteins in Arabidopsis.
    J. Biol. Chem., 2012. 287(17): p. 14109-21
    [PMID:22334670]
  34. Tominaga-Wada R, et al.
    Functional divergence of MYB-related genes, WEREWOLF and AtMYB23 in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2012. 76(5): p. 883-7
    [PMID:22738953]
  35. Wieckowski Y,Schiefelbein J
    Nuclear ribosome biogenesis mediated by the DIM1A rRNA dimethylase is required for organized root growth and epidermal patterning in Arabidopsis.
    Plant Cell, 2012. 24(7): p. 2839-56
    [PMID:22829145]
  36. Ibarra SE,Auge G,S
    Transcriptional programs related to phytochrome A function in Arabidopsis seed germination.
    Mol Plant, 2013. 6(4): p. 1261-73
    [PMID:23292879]
  37. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  38. Yao H,Wang G,Guo L,Wang X
    Phosphatidic acid interacts with a MYB transcription factor and regulates its nuclear localization and function in Arabidopsis.
    Plant Cell, 2013. 25(12): p. 5030-42
    [PMID:24368785]
  39. Cheng Y, et al.
    Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
    Elife, 2018.
    [PMID:24771765]
  40. Pietra S,Lang P,Grebe M
    SABRE is required for stabilization of root hair patterning in Arabidopsis thaliana.
    Physiol Plant, 2015. 153(3): p. 440-53
    [PMID:25124848]
  41. Kiefer CS, et al.
    Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
    Development, 2015. 142(1): p. 151-61
    [PMID:25428588]
  42. Kiefer CS, et al.
    Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
    Development, 2015. 142(5): p. 1022
    [PMID:25715402]
  43. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  44. Song SK,Kwak SH,Chang SC,Schiefelbein J,Lee MM
    WEREWOLF and ENHANCER of GLABRA3 are interdependent regulators of the spatial expression pattern of GLABRA2 in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2015. 467(1): p. 94-100
    [PMID:26408906]
  45. Kwak SH,Song SK,Lee MM,Schiefelbein J
    TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(12): p. e1103407
    [PMID:26451798]
  46. Zhu Y, et al.
    The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
    Plant Cell, 2017. 29(2): p. 260-276
    [PMID:28138017]
  47. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  48. Mira MM, et al.
    Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
    J. Exp. Bot., 2017. 68(20): p. 5653-5668
    [PMID:29059380]
  49. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]
  50. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]