PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G14000.1
Common Nameanac084, NAC084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 206aa    MW: 23487.7 Da    PI: 9.4831
Description NAC domain containing protein 84
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G14000.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.75.8e-33151401128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lp G+rFhPt++el+ +yL +k+ +++l+  ++i+ +d++ ++P ++p   +++ek+ yfF+k+++ +++++r + +  +gyWk  gk++++++  g+
  AT5G14000.1  15 LPIGYRFHPTEQELILHYLLPKAFASPLPS-SIIPVFDLFFSHPLSFPG--DQKEKQRYFFCKKREVSSNEHRIKISSGDGYWKPIGKERPIIA-CGK 108
                  699*************************99.88***************4..4578899************************************.999 PP

          NAM  99 lvglkktLvfykg..rapkgektdWvmheyrl 128
                  + g+++tL+fy+   +++  +kt+W m ey l
  AT5G14000.1 109 TFGIRRTLAFYETnkSSSYCNKTRWSMTEYCL 140
                  ***********7611445567*********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-4010159IPR003441NAC domain
PROSITE profilePS5100536.98915160IPR003441NAC domain
PfamPF023652.0E-1916140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009031anatomysepal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001185developmental stageplant embryo globular stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEVEKRIVVN GGMKLPIGYR FHPTEQELIL HYLLPKAFAS PLPSSIIPVF DLFFSHPLSF  60
PGDQKEKQRY FFCKKREVSS NEHRIKISSG DGYWKPIGKE RPIIACGKTF GIRRTLAFYE  120
TNKSSSYCNK TRWSMTEYCL AGFASAKVSG EWAVYNVYER KGSKGRKQRK SREGDDEELR  180
CIDHFTVGSN HETGPPPPSP PTSADE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-211314013140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.319910.0flower| leaf| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306847070.0
Genevisible250208_at0.0
Expression AtlasAT5G14000-
AtGenExpressAT5G14000-
ATTED-IIAT5G14000-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G14000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G14000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0062540.0BT006254.1 Arabidopsis thaliana At5g14000 mRNA, complete cds.
GenBankAY0996350.0AY099635.1 Arabidopsis thaliana unknown protein (At5g14000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568292.11e-153NAC domain containing protein 84
TrEMBLQ9FFX51e-153Q9FFX5_ARATH; At5g14000
STRINGAT5G14000.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78742541
Representative plantOGRP1179656
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Payne T,Johnson SD,Koltunow AM
    KNUCKLES (KNU) encodes a C2H2 zinc-finger protein that regulates development of basal pattern elements of the Arabidopsis gynoecium.
    Development, 2004. 131(15): p. 3737-49
    [PMID:15240552]
  4. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  5. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]