PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G13180.1
Common NameANAC083, NAC083, T19L5.140, VNI2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 252aa    MW: 28569.9 Da    PI: 9.1386
Description NAC domain containing protein 83
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G13180.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.42e-51141381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLk+kv +++l++ ++i+e+d+++++PwdLp +    eke yfFs+r+ ky++g+r+nrat sgyWkatg dk+v+++ ++
  AT5G13180.1  14 LPPGFRFHPTDEELVVQYLKRKVCSSPLPA-SIIPEFDVCRADPWDLPGN---LEKERYFFSTREAKYPNGNRSNRATGSGYWKATGIDKRVVTSrGN 107
                  79****************************.89***************44...4789********************************999988577 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vglkktLvfykg+ p+g++tdW+mheyrl
  AT5G13180.1 108 QIVGLKKTLVFYKGKPPHGSRTDWIMHEYRL 138
                  77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6010160IPR003441NAC domain
PROSITE profilePS5100558.55814160IPR003441NAC domain
PfamPF023653.0E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0016032Biological Processviral process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0000293anatomyguard cell
PO:0005421anatomyparenchyma
PO:0006077anatomyprotophloem
PO:0006307anatomyroot procambium
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009053anatomypeduncle
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MDNVKLVKNG VLRLPPGFRF HPTDEELVVQ YLKRKVCSSP LPASIIPEFD VCRADPWDLP  60
GNLEKERYFF STREAKYPNG NRSNRATGSG YWKATGIDKR VVTSRGNQIV GLKKTLVFYK  120
GKPPHGSRTD WIMHEYRLSS SPPSSMGPTQ NWVLCRIFLK KRAGNKNDDD DGDSRNLRHN  180
NNNNSSDQIE IITTDQTDDK TKPIFFDFMR KERTTDLNLL PSSPSSDHAS SGVTTEIFSS  240
SDEETSSCNS FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-531216615171NO APICAL MERISTEM PROTEIN
1ut4_B8e-531216615171NO APICAL MERISTEM PROTEIN
1ut7_A8e-531216615171NO APICAL MERISTEM PROTEIN
1ut7_B8e-531216615171NO APICAL MERISTEM PROTEIN
3swm_A8e-531216618174NAC domain-containing protein 19
3swm_B8e-531216618174NAC domain-containing protein 19
3swm_C8e-531216618174NAC domain-containing protein 19
3swm_D8e-531216618174NAC domain-containing protein 19
3swp_A8e-531216618174NAC domain-containing protein 19
3swp_B8e-531216618174NAC domain-containing protein 19
3swp_C8e-531216618174NAC domain-containing protein 19
3swp_D8e-531216618174NAC domain-containing protein 19
4dul_A8e-531216615171NAC domain-containing protein 19
4dul_B8e-531216615171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.100790.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453579580.0
Genevisible245987_at0.0
Expression AtlasAT5G13180-
AtGenExpressAT5G13180-
ATTED-IIAT5G13180-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}.
UniprotTISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a NAC domain transcription factor that interacts with VND7 and negatively regulates xylem vessel formation.
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Function -- GeneRIF ? help Back to Top
  1. VNI2 regulates xylem cell specification as a transcriptional repressor that interacts with VND proteins and possibly with other NAC domain proteins.
    [PMID: 20388856]
  2. These observations indicate that the VNI2 transcription factor serves as a molecular link that integrates plant responses to environmental stresses into modulation of leaf longevity.
    [PMID: 21673078]
  3. Arabidopsis thaliana NAC083 protein interacts with Mungbean yellow mosaic India virus Rep protein.
    [PMID: 24442717]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G13180.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G53950, AT5G62380, AT5G63790, AT5G66300, AT1G56010, AT1G71930
IntActSearch Q9FY93
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Accelerated leaf aging. {ECO:0000269|PubMed:21673078}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G13180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1439640.0AY143964.1 Arabidopsis thaliana At5g13180/T19L5_140 mRNA, complete cds.
GenBankAF3857340.0AF385734.1 Arabidopsis thaliana AT5g13180/T19L5_140 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196822.10.0NAC domain containing protein 83
SwissprotQ9FY930.0NAC83_ARATH; NAC domain-containing protein 83
TrEMBLD7M5770.0D7M577_ARALL; ANAC083
STRINGAT5G13180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM18062786
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Guti
    Phylogenetic profiling of the Arabidopsis thaliana proteome: what proteins distinguish plants from other organisms?
    Genome Biol., 2004. 5(8): p. R53
    [PMID:15287975]
  5. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  6. Ay N, et al.
    Epigenetic programming via histone methylation at WRKY53 controls leaf senescence in Arabidopsis thaliana.
    Plant J., 2009. 58(2): p. 333-46
    [PMID:19143996]
  7. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]
  8. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  9. Yang SD,Seo PJ,Yoon HK,Park CM
    The Arabidopsis NAC transcription factor VNI2 integrates abscisic acid signals into leaf senescence via the COR/RD genes.
    Plant Cell, 2011. 23(6): p. 2155-68
    [PMID:21673078]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Seo PJ,Park CM
    Signaling linkage between environmental stress resistance and leaf senescence in Arabidopsis.
    Plant Signal Behav, 2011. 6(10): p. 1564-6
    [PMID:21921691]
  12. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  13. Suyal G,Rana VS,Mukherjee SK,Wajid S,Choudhury NR
    Arabidopsis thaliana NAC083 protein interacts with Mungbean yellow mosaic India virus (MYMIV) Rep protein.
    Virus Genes, 2014. 48(3): p. 486-93
    [PMID:24442717]