PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G11510.1
Common NameAtMYB3R4, MYB3R4, MYB3R-4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 961aa    MW: 108236 Da    PI: 5.4835
Description myb domain protein 3r-4
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G11510.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-182975148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde+l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
      AT5G11510.1 29 RGQWTAEEDEILRKAVHSFKGKNWKKIAEYFK-DRTDVQCLHRWQKVL 75
                     89*****************************9.************986 PP

2Myb_DNA-binding62.67.8e-2081127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde +v++++++G++ W+tIar ++ gR +kqc++rw+++l
      AT5G11510.1  81 KGPWTKEEDEMIVQLIEKYGPKKWSTIARFLP-GRIGKQCRERWHNHL 127
                      79******************************.*************97 PP

3Myb_DNA-binding45.51.8e-14133175145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ll++a++ +G++ W+   + ++ gR+++ +k++w+
      AT5G11510.1 133 KEAWTQEEELLLIRAHQIYGNR-WAELTKFLP-GRSDNGIKNHWH 175
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2942475IPR017930Myb domain
SuperFamilySSF466892.08E-152681IPR009057Homeodomain-like
SMARTSM007171.2E-152877IPR001005SANT/Myb domain
PfamPF002492.1E-162975IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-223083IPR009057Homeodomain-like
CDDcd001674.30E-143275No hitNo description
PROSITE profilePS5129432.60976131IPR017930Myb domain
SuperFamilySSF466896.36E-3278174IPR009057Homeodomain-like
SMARTSM007173.5E-1980129IPR001005SANT/Myb domain
PfamPF002491.1E-1781127IPR001005SANT/Myb domain
CDDcd001675.30E-1783127No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2784131IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-20132182IPR009057Homeodomain-like
PROSITE profilePS5129418.591132182IPR017930Myb domain
SMARTSM007171.4E-13132180IPR001005SANT/Myb domain
PfamPF002499.2E-13133175IPR001005SANT/Myb domain
CDDcd001671.39E-10135175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0003713Molecular Functiontranscription coactivator activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000026anatomyprimary root tip
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020121anatomylateral root
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MEAESSTPQE RIPKLRHGRT SGPARRSTRG QWTAEEDEIL RKAVHSFKGK NWKKIAEYFK  60
DRTDVQCLHR WQKVLNPELV KGPWTKEEDE MIVQLIEKYG PKKWSTIARF LPGRIGKQCR  120
ERWHNHLNPA INKEAWTQEE ELLLIRAHQI YGNRWAELTK FLPGRSDNGI KNHWHSSVKK  180
KLDSYMSSGL LDQYQAMPLA PYERSSTLQS TFMQSNIDGN GCLNGQAENE IDSRQNSSMV  240
GCSLSARDFQ NGTINIGHDF HPCGNSQENE QTAYHSEQFY YPELEDISVS ISEVSYDMED  300
CSQFPDHNVS TSPSQDYQFD FQELSDISLE MRHNMSEIPM PYTKESKEST LGAPNSTLNI  360
DVATYTNSAN VLTPETECCR VLFPDQESEG HSVSRSLTQE PNEFNQVDRR DPILYSSASD  420
RQISEATKSP TQSSSSRFTA TAASGKGTLR PAPLIISPDK YSKKSSGLIC HPFEVEPKCT  480
TNGNGSFICI GDPSSSTCVD EGTNNSSEED QSYHVNDPKK LVPVNDFASL AEDRPHSLPK  540
HEPNMTNEQH HEDMGASSSL GFPSFDLPVF NCDLLQSKND PLHDYSPLGI RKLLMSTMTC  600
MSPLRLWESP TGKKTLVGAQ SILRKRTRDL LTPLSEKRSD KKLEIDIAAS LAKDFSRLDV  660
MFDETENRQS NFGNSTGVIH GDRENHFHIL NGDGEEWSGK PSSLFSHRMP EETMHIRKSL  720
EKVDQICMEA NVREKDDSEQ DVENVEFFSG ILSEHNTGKP VLSTPGQSVT KAEKAQVSTP  780
RNQLQRTLMA TSNKEHHSPS SVCLVINSPS RARNKEGHLV DNGTSNENFS IFCGTPFRRG  840
LESPSAWKSP FYINSLLPSP RFDTDLTIED MGYIFSPGER SYESIGVMTQ INEHTSAFAA  900
FADAMEVSIS PTNDDARQKK ELDKENNDPL LAERRVLDFN DCESPIKATE EVSSYLLKGC  960
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-67291826159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-67291826159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.51320.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250386_at0.0
Expression AtlasAT5G11510-
AtGenExpressAT5G11510-
ATTED-IIAT5G11510-
Functional Description ? help Back to Top
Source Description
TAIRArabidopsis thaliana putative c-myb-like transcription factor MYB3R-4. Functions in powdery mildew induced host endoreduplication at the site of infection.
Function -- GeneRIF ? help Back to Top
  1. Our results suggest that a pair of structurally related myb3r1 myb3r4 transcription factors may positively regulate cytokinesis mainly through transcriptional activation of the KN gene.
    [PMID: 17287251]
  2. MYB3R1 and MYB3R4 may have diverse roles during plant development by regulating G2/M-specific genes with various functions as well as genes possibly unrelated to the cell cycle.
    [PMID: 21862669]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G11510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G08560(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G11510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196500.0AY519650.1 Arabidopsis thaliana MYB transcription factor (At5g11510) mRNA, complete cds.
GenBankAF3719750.0AF371975.2 Arabidopsis thaliana putative c-myb-like transcription factor MYB3R-4 (MYB3R4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568249.10.0putative c-myb-like transcription factor MYB3R-4
TrEMBLQ94FL90.0Q94FL9_ARATH; MYB transcription factor
STRINGAT5G11510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Representative plantOGRP9448613
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Menges M,de Jager SM,Gruissem W,Murray JA
    Global analysis of the core cell cycle regulators of Arabidopsis identifies novel genes, reveals multiple and highly specific profiles of expression and provides a coherent model for plant cell cycle control.
    Plant J., 2005. 41(4): p. 546-66
    [PMID:15686519]
  4. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  5. Nawy T, et al.
    Transcriptional profile of the Arabidopsis root quiescent center.
    Plant Cell, 2005. 17(7): p. 1908-25
    [PMID:15937229]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Okada T,Bhalla PL,Singh MB
    Expressed sequence tag analysis of Lilium longiflorum generative cells.
    Plant Cell Physiol., 2006. 47(6): p. 698-705
    [PMID:16571618]
  8. Haga N, et al.
    R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.
    Development, 2007. 134(6): p. 1101-10
    [PMID:17287251]
  9. L
    Distinct light-initiated gene expression and cell cycle programs in the shoot apex and cotyledons of Arabidopsis.
    Plant Cell, 2008. 20(4): p. 947-68
    [PMID:18424613]
  10. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  11. Ma Q, et al.
    Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is mediated by alteration in cell cycle and ectopic expression of stress genes.
    Plant Physiol., 2009. 150(1): p. 244-56
    [PMID:19279197]
  12. Chandran D,Inada N,Hather G,Kleindt CK,Wildermuth MC
    Laser microdissection of Arabidopsis cells at the powdery mildew infection site reveals site-specific processes and regulators.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(1): p. 460-5
    [PMID:20018666]
  13. Haga N, et al.
    Mutations in MYB3R1 and MYB3R4 cause pleiotropic developmental defects and preferential down-regulation of multiple G2/M-specific genes in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 706-17
    [PMID:21862669]
  14. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]