PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G11270.1
Common NameF2I11.160, OCP3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HB-other
Protein Properties Length: 354aa    MW: 39111.5 Da    PI: 4.5291
Description overexpressor of cationic peroxidase 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G11270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.3e-08292339653
                  S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
     Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                  + +k  +e+Le+++++++ p+ +    + + ++L+ ++V  WF  +Ra
  AT5G11270.1 292 RVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEDKRA 339
                  567899*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.669284344IPR001356Homeobox domain
SuperFamilySSF466895.99E-8289344IPR009057Homeodomain-like
SMARTSM003897.8E-4290348IPR001356Homeobox domain
PfamPF000464.6E-6292339IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-7292350IPR009057Homeodomain-like
CDDcd000861.38E-5295339No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:0055114Biological Processoxidation-reduction process
GO:0098869Biological Processcellular oxidant detoxification
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004601Molecular Functionperoxidase activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MIKAMALSSA GVVSHLHPPS FSSSSGLSVN RVLFRNRNAS PCGLSLPILN PSRSVLVFAR  60
GKNRKGFVSS SSSSPKKNKK KSLDGADNGG GEEEEDPFEA LFNLLEEDLK NDNSDDEEIS  120
EEELEALADE LARALGVGDD VDDIDLFGSV TGDVDVDVDN DDDDNDDDDN DDDDDDSEED  180
ERPTKLKNWQ LKRLAYALKA GRRKTSIKNL AAEVCLDRAY VLELLRDPPP KLLMLSATLP  240
DEKPPVAAPE NSSPDPSPVE SLSAEDVVVE PKEKVKDEAV HVMQQRWSAQ KRVKKAHIET  300
LEKVYRRSKR PTNAVVSSIV QVTNLPRKRV LKWFEDKRAE DGVPDKRAPY QAPV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.434570.0bud| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453578890.0
Genevisible250421_at0.0
Expression AtlasAT5G11270-
AtGenExpressAT5G11270-
ATTED-IIAT5G11270-
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeodomain transcription factor involved in mediating resistance to infection by necrotrophic pathogens dependent on perception of jasmonic acid through COI1. Expressed in the nucleus. Downregulated upon fungal infection. Also involved in drought tolerance.
UniProtMay modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid- (JA)-mediated COI1-dependent and abscisic acid- (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. Botrytis cinerea and Plectosphaerella cucumerina) and bacterial pathogens (e.g. Pseudomonas syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the Pseudomonas fluorescens WCS417r- triggered jasmonic acid-dependent induced systemic resistance (ISR) against both Pseudomonas syringae DC3000 and Hyaloperonospora arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}.
Function -- GeneRIF ? help Back to Top
  1. OCP3 is an important factor for the COI1-dependent resistance of plants to infection by necrotrophic pathogens.
    [PMID: 15923348]
  2. OCP3 plays a pivotal role in the signal pathway controlling drought tolerance through the modulation of ABA-mediated stomatal closure. This function is ABA-dependent but MeJA-independent
    [PMID: 19175769]
  3. OCP3 may modulate the nucleocytosolic function of NPR1 in the regulation of jasmonic acid-dependent induced defense responses.
    [PMID: 20836879]
  4. OCP3 represents a specific control point for callose deposition regulated by jasmonic acid yet ultimately requiring abscisic acid.
    [PMID: 21564353]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G11270.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G15800, AT5G63790
IntActSearch Q8H0V5
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G11270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0087430.0BT008743.1 Arabidopsis thaliana At5g11270 gene, complete cds.
GenBankBT0020170.0BT002017.1 Arabidopsis thaliana putative protein (At5g11270) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196688.20.0overexpressor of cationic peroxidase 3
SwissprotQ8H0V50.0OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLD7M3N90.0D7M3N9_ARALL; Putative uncharacterized protein
STRINGAT5G11270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP69271618
MalvidsOGEM120772631
Publications ? help Back to Top
  1. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Coego A,Ramirez V,Ellul P,Mayda E,Vera P
    The H2O2-regulated Ep5C gene encodes a peroxidase required for bacterial speck susceptibility in tomato.
    Plant J., 2005. 42(2): p. 283-93
    [PMID:15807789]
  4. Coego A, et al.
    An Arabidopsis homeodomain transcription factor, OVEREXPRESSOR OF CATIONIC PEROXIDASE 3, mediates resistance to infection by necrotrophic pathogens.
    Plant Cell, 2005. 17(7): p. 2123-37
    [PMID:15923348]
  5. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  6. Ramírez V, et al.
    Drought tolerance in Arabidopsis is controlled by the OCP3 disease resistance regulator.
    Plant J., 2009. 58(4): p. 578-91
    [PMID:19175769]
  7. Ram
    OCP3 is an important modulator of NPR1-mediated jasmonic acid-dependent induced defenses in Arabidopsis.
    BMC Plant Biol., 2010. 10: p. 199
    [PMID:20836879]
  8. Garc
    Arabidopsis ocp3 mutant reveals a mechanism linking ABA and JA to pathogen-induced callose deposition.
    Plant J., 2011. 67(5): p. 783-94
    [PMID:21564353]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  10. Jones AM, et al.
    Border control--a membrane-linked interactome of Arabidopsis.
    Science, 2014. 344(6185): p. 711-6
    [PMID:24833385]