PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G11060.1
Common NameKNAT4, T5K6_50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 393aa    MW: 44385.1 Da    PI: 6.268
Description KNOTTED1-like homeobox gene 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G11060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.41e-073333652254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   +yp++e++++L +++gL+ +q+ +WF N+R +
  AT5G11060.1 333 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 365
                  69*****************************87 PP

2ELK28.92.5e-10286307122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELKh+L+++Y+++++++++E++
  AT5G11060.1 286 ELKHELKQGYKEKIVDIREEIL 307
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-19121165IPR005540KNOX1
PfamPF037901.0E-17124164IPR005540KNOX1
SMARTSM012564.3E-28177232IPR005541KNOX2
PfamPF037911.7E-20182231IPR005541KNOX2
SMARTSM011886.1E-4286307IPR005539ELK domain
PROSITE profilePS512139.969286306IPR005539ELK domain
PfamPF037899.0E-7286307IPR005539ELK domain
PROSITE profilePS5007111.758306369IPR001356Homeobox domain
SMARTSM003895.2E-11308373IPR001356Homeobox domain
SuperFamilySSF466895.13E-16308372IPR009057Homeodomain-like
CDDcd000865.66E-11309370No hitNo description
Gene3DG3DSA:1.10.10.604.5E-25313370IPR009057Homeodomain-like
PfamPF059201.1E-17326365IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0005059anatomyroot endodermis
PO:0005417anatomyphloem
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025181anatomyroot elongation zone
PO:0025257anatomyprimary root elongation zone
PO:0025281anatomypollen
PO:0001031developmental stage4 root elongation stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MAFHNNHFNH FTDQQQHQPP PPPQQQQQQH FQESAPPNWL LRSDNNFLNL HTAASAAATS  60
SDSPSSAAAN QWLSRSSSFL QRGNTANNNN NETSGDVIED VPGGEESMIG EKKEAERWQN  120
ARHKAEILSH PLYEQLLSAH VACLRIATPV DQLPRIDAQL AQSQNVVAKY STLEAAQGLL  180
AGDDKELDHF MTHYVLLLCS FKEQLQQHVR VHAMEAVMAC WEIEQSLQSF TGVSPGEGTG  240
ATMSEDEDEQ VESDAHLFDG SLDGLGFGPL VPTESERSLM ERVRQELKHE LKQGYKEKIV  300
DIREEILRKR RAGKLPGDTT SVLKSWWQSH SKWPYPTEED KARLVQETGL QLKQINNWFI  360
NQRKRNWHSN PSSSTVSKNK RRSNAGENSG RDR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A5e-13309373872Homeobox protein PKNOX1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.53770.0flower| inflorescence| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245901_at0.0
Expression AtlasAT5G11060-
AtGenExpressAT5G11060-
ATTED-IIAT5G11060-
Functional Description ? help Back to Top
Source Description
TAIRA member of Class II KN1-like homeodomain transcription factors (together with KNAT3 and KNAT5), with greatest homology to the maize knox1 homeobox protein. Expression regulated by light. Detected in all tissues examined, but most prominent in leaves and young siliques. Transient expression of GFP translational fusion protein suggests bipartite localization in nucleus and cytoplasm. KNAT4 promoter activity showed cell-type specific pattern along longitudinal root axis; GUS expression pattern started at the elongation zone, predominantly in the phloem and pericycle cells, extending to endodermis toward the base of the root.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G11060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G25220, AT1G62990
IntActSearch P48001
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G11060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1182960.0AK118296.1 Arabidopsis thaliana At5g11060 mRNA for putative HOMEOBOX PROTEIN KNOTTED-1 LIKE 4 (KNAT4), complete cds, clone: RAFL19-58-H14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196667.20.0homeobox protein knotted-1-like 4
SwissprotP480010.0KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLD7M3L60.0D7M3L6_ARALL; KNAT4 homeobox protein
STRINGAT5G11060.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MalvidsOGEM44428158
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Bellaoui M, et al.
    The Arabidopsis BELL1 and KNOX TALE homeodomain proteins interact through a domain conserved between plants and animals.
    Plant Cell, 2001. 13(11): p. 2455-70
    [PMID:11701881]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Hudson ME,Lisch DR,Quail PH
    The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.
    Plant J., 2003. 34(4): p. 453-71
    [PMID:12753585]
  5. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  6. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  7. Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
    A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12
    [PMID:15781858]
  8. Ehlting J, et al.
    Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
    Plant J., 2005. 42(5): p. 618-40
    [PMID:15918878]
  9. Darrah C, et al.
    Analysis of phase of LUCIFERASE expression reveals novel circadian quantitative trait loci in Arabidopsis.
    Plant Physiol., 2006. 140(4): p. 1464-74
    [PMID:16461388]
  10. Truernit E,Siemering KR,Hodge S,Grbic V,Haseloff J
    A map of KNAT gene expression in the Arabidopsis root.
    Plant Mol. Biol., 2006. 60(1): p. 1-20
    [PMID:16463096]
  11. Magnani E,Hake S
    KNOX lost the OX: the Arabidopsis KNATM gene defines a novel class of KNOX transcriptional regulators missing the homeodomain.
    Plant Cell, 2008. 20(4): p. 875-87
    [PMID:18398054]
  12. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Truernit E,Haseloff J
    A Role for KNAT Class II Genes in Root Development.
    Plant Signal Behav, 2007. 2(1): p. 10-2
    [PMID:19704797]
  15. Serikawa KA,Martinez-Laborda A,Zambryski P
    Three knotted1-like homeobox genes in Arabidopsis.
    Plant Mol. Biol., 1996. 32(4): p. 673-83
    [PMID:8980519]