PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G10120.1
Common NameEIL4, T31P16_110
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family EIL
Protein Properties Length: 471aa    MW: 53954.1 Da    PI: 5.1377
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G10120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         EIN3   1 eelkkrmwkdqmllk.rlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWke 97 
                  ++lk+rmwkd++l++ +lk++k++   ++++ ++ +   ++ e++rrkkm+r+QD++LkYM+k+mevc+a+GfvYgi+pekgkp +g+sdsLr+WWke
                  79************9345555554...4565.5555..489********************************************************* PP

         EIN3  98 kvefdrngpaaisky...qaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgt 192
                  +v+fd+n+p ai++y   +a+ ++++  ++ ++++ss  h+l+elqDTtlgSLLsalmqhc+ppqrrfplekg++pPWWPtG+elwwge+g+++++g+
                  ***************976333333332222.3458999************************************************************ PP

         EIN3 193 ppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekeca 258
                  ppy+kphdl+k wkvsvL+avikhmsp++ ++r+l+rqsk+lqdkm+ake++++++vlnqee++++
                  **************************************************************9864 PP

         EIN3 302 agfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  ++++  +krk     s++++ ++ ++tcq+s++++s+++++f dkns++ +e
                  4555566666.....5566666678************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.5E-11623273No hitNo description
Gene3DG3DSA:1.10.3180.102.3E-67146277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.12E-58152276IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0001081developmental stagemature plant embryo stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-571532754126Protein ETHYLENE INSENSITIVE 3
4zds_B2e-571532754126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasAT5G10120-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G10120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3563320.0AL356332.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T31P16 (ESSA project).
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196574.10.0Ethylene insensitive 3 family protein
SwissprotQ9LX160.0EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A178U9150.0A0A178U915_ARATH; Uncharacterized protein
STRINGAT5G10120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5631682
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
  2. Rieu I,Mariani C,Weterings K
    Expression analysis of five tobacco EIN3 family members in relation to tissue-specific ethylene responses.
    J. Exp. Bot., 2003. 54(391): p. 2239-44
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
  4. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
  5. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
  6. Binder BM, et al.
    The Arabidopsis EIN3 binding F-Box proteins EBF1 and EBF2 have distinct but overlapping roles in ethylene signaling.
    Plant Cell, 2007. 19(2): p. 509-23
  7. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
  8. Jeong HJ,Choi JY,Shin HY,Bae JM,Shin JS
    Seed-specific expression of seven Arabidopsis promoters.
    Gene, 2014. 553(1): p. 17-23