PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G10120.1
Common NameEIL4, T31P16_110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family EIL
Protein Properties Length: 471aa    MW: 53954.1 Da    PI: 5.1377
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G10120.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3391.89.2e-120232771258
                  XXXXXXXXXXXXXXX.XXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllk.rlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWke 97 
                  ++lk+rmwkd++l++ +lk++k++   ++++ ++ +   ++ e++rrkkm+r+QD++LkYM+k+mevc+a+GfvYgi+pekgkp +g+sdsLr+WWke
  AT5G10120.1  23 DDLKRRMWKDRNLMEkKLKQQKRH---SNDV-VSFT--THRAEASRRKKMARSQDSVLKYMMKIMEVCKAKGFVYGIVPEKGKPITGSSDSLRRWWKE 114
                  79************9345555554...4565.5555..489********************************************************* PP

                  XXXXXXXXXXXXXXX...XXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--. CS
         EIN3  98 kvefdrngpaaisky...qaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgt 192
                  +v+fd+n+p ai++y   +a+ ++++  ++ ++++ss  h+l+elqDTtlgSLLsalmqhc+ppqrrfplekg++pPWWPtG+elwwge+g+++++g+
  AT5G10120.1 115 NVQFDQNAPDAITDYlalAAAAAAAELIDK-SSSSSSLLHMLQELQDTTLGSLLSALMQHCMPPQRRFPLEKGIAPPWWPTGTELWWGEQGAAHEHGA 211
                  ***************976333333332222.3458999************************************************************ PP

                  -----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S- CS
         EIN3 193 ppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekeca 258
                  ppy+kphdl+k wkvsvL+avikhmsp++ ++r+l+rqsk+lqdkm+ake++++++vlnqee++++
  AT5G10120.1 212 PPYRKPHDLRKSWKVSVLAAVIKHMSPNLGRVRRLARQSKSLQDKMMAKETDTWSRVLNQEEALLN 277
                  **************************************************************9864 PP

2EIN322.41.9e-07289335302353
                  XXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 302 agfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  ++++  +krk     s++++ ++ ++tcq+s++++s+++++f dkns++ +e
  AT5G10120.1 289 DQESSGSKRK-----SESMEPSKSVYTCQNSSCPKSDVSFGFGDKNSRTGHE 335
                  4555566666.....5566666678************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.5E-11623273No hitNo description
Gene3DG3DSA:1.10.3180.102.3E-67146277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.12E-58152276IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0009010anatomyseed
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0001081developmental stagemature plant embryo stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MVEVEELEPL SPMDDEEEEI SYDDLKRRMW KDRNLMEKKL KQQKRHSNDV VSFTTHRAEA  60
SRRKKMARSQ DSVLKYMMKI MEVCKAKGFV YGIVPEKGKP ITGSSDSLRR WWKENVQFDQ  120
NAPDAITDYL ALAAAAAAAE LIDKSSSSSS LLHMLQELQD TTLGSLLSAL MQHCMPPQRR  180
FPLEKGIAPP WWPTGTELWW GEQGAAHEHG APPYRKPHDL RKSWKVSVLA AVIKHMSPNL  240
GRVRRLARQS KSLQDKMMAK ETDTWSRVLN QEEALLNIKD LKISEDQDDQ ESSGSKRKSE  300
SMEPSKSVYT CQNSSCPKSD VSFGFGDKNS RTGHEIQCLY GSNQEPSQSG EYTSSLLETV  360
PSIVTNSTSE DDYYNVSSRA LDKRDDDDHS INGNWMEYFW LEKMQQEFHC SRRFEDDEGT  420
GTDFDQLTES DRSDNVNLNQ LTKSDRSDNV NRSAFSVWDM GCEDKDIYMF D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-571532754126Protein ETHYLENE INSENSITIVE 3
4zds_B2e-571532754126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184161870.0
Genevisible250468_at0.0
Expression AtlasAT5G10120-
AtGenExpressAT5G10120-
ATTED-IIAT5G10120-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G10120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G10120
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3563320.0AL356332.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T31P16 (ESSA project).
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196574.10.0Ethylene insensitive 3 family protein
SwissprotQ9LX160.0EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A178U9150.0A0A178U915_ARATH; Uncharacterized protein
STRINGAT5G10120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Representative plantOGRP5631682
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Rieu I,Mariani C,Weterings K
    Expression analysis of five tobacco EIN3 family members in relation to tissue-specific ethylene responses.
    J. Exp. Bot., 2003. 54(391): p. 2239-44
    [PMID:12909687]
  3. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  4. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  5. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  6. Binder BM, et al.
    The Arabidopsis EIN3 binding F-Box proteins EBF1 and EBF2 have distinct but overlapping roles in ethylene signaling.
    Plant Cell, 2007. 19(2): p. 509-23
    [PMID:17307926]
  7. Nelson DC, et al.
    Karrikins enhance light responses during germination and seedling development in Arabidopsis thaliana.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(15): p. 7095-100
    [PMID:20351290]
  8. Jeong HJ,Choi JY,Shin HY,Bae JM,Shin JS
    Seed-specific expression of seven Arabidopsis promoters.
    Gene, 2014. 553(1): p. 17-23
    [PMID:25261846]