PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G09330.2
Common NameANAC082, NAC082, T5E8.130, VNI1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 489aa    MW: 54442.5 Da    PI: 4.4725
Description NAC domain containing protein 82
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G09330.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.73.4e-4761331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  l+pGfrFhPtd elv +yLk+k+ gkkl + ++i+evdiyk+eP dLp +  +++++ +w+fF++r+kkya+g r+nrat+ gyWk+tgk+++vl+ +
  AT5G09330.2   6 LAPGFRFHPTDVELVRYYLKRKILGKKLLV-DAIAEVDIYKFEPPDLPdMsFIRSGDLKWHFFCPREKKYASGVRANRATECGYWKTTGKERPVLC-N 101
                  579************************999.89**************96346777888**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +e+vg  ktLv++ g++p+ge+tdWvmheyrl
  AT5G09330.2 102 SEVVGKIKTLVYHFGKSPRGERTDWVMHEYRL 133
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-573156IPR003441NAC domain
PROSITE profilePS5100552.3116156IPR003441NAC domain
PfamPF023651.1E-258133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0005417anatomyphloem
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020094anatomyplant egg cell
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MGKTQLAPGF RFHPTDVELV RYYLKRKILG KKLLVDAIAE VDIYKFEPPD LPDMSFIRSG  60
DLKWHFFCPR EKKYASGVRA NRATECGYWK TTGKERPVLC NSEVVGKIKT LVYHFGKSPR  120
GERTDWVMHE YRLDDKVLTQ MNVPQDTYVV CVLFKKDGPG PRNGAQYGAP FKEEDWSDEE  180
VRTDVPSTSN PTNLLEPSKE TTLALTAPDD SNKDCFGGMI SESCVSDFLP ATTNTTSELP  240
HPSDAATTPM STAPLAETVQ TPNNDDLYSM LDLFDDDEEF LGFNNNEVRY DPGVSAPVCL  300
EEEGIFNGLP ELSSMPRTAS YDLVENSELY LELQDLTAPL NPQTGLQDLT APFNPQTGLQ  360
DLTAPFNHQT GLQDHTAPFN PQTGLQDHTA PFNHQTGLQD LTAPFNPQTG LQDLTAPFNP  420
QTGLHDLTSP FNPQTGLQDL TAPLNPQTGN RNDPRSSSFL YNQGHFDFSG GNDDDPYGFS  480
ASMRHRPKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-42615615168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.480140.0bud| flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245934_at0.0
Expression AtlasAT5G09330-
AtGenExpressAT5G09330-
ATTED-IIAT5G09330-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G09330.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FY82
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G09330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3172170.0AK317217.1 Arabidopsis thaliana AT5G09330 mRNA, complete cds, clone: RAFL22-35-P15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001154700.10.0NAC domain containing protein 82
RefseqNP_196495.10.0NAC domain containing protein 82
RefseqNP_001078551.10.0NAC domain containing protein 82
RefseqNP_001078552.10.0NAC domain containing protein 82
SwissprotQ9FY820.0NAC82_ARATH; NAC domain-containing protein 82
TrEMBLD7M2270.0D7M227_ARALL; Putative uncharacterized protein
STRINGAT5G09330.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Kamada T, et al.
    Functional differentiation of peroxisomes revealed by expression profiles of peroxisomal genes in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(12): p. 1275-89
    [PMID:14701923]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Jaspers P, et al.
    Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.
    Plant J., 2009. 60(2): p. 268-79
    [PMID:19548978]
  5. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  6. Yamaguchi M, et al.
    VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.
    Plant Cell, 2010. 22(4): p. 1249-63
    [PMID:20388856]