PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G08790.1
Common Nameanac081, ATAF2, NAC081, T2K12.140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 283aa    MW: 32225.2 Da    PI: 5.4696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G08790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.2e-5171311128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lp+GfrFhPtdeelv++yL++k++++++++  vi+e+d+yk++Pw+Lp++   +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   +
  AT5G08790.1   7 LPAGFRFHPTDEELVKFYLCRKCASEQISA-PVIAEIDLYKFNPWELPEMSLYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PK 101
                  799*************************99.89***************66566899************************************98..77 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  + g+kk Lvfy g+apkg kt+W+mheyrl
  AT5G08790.1 102 TLGIKKALVFYAGKAPKGIKTNWIMHEYRL 131
                  8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-604159IPR003441NAC domain
PROSITE profilePS5100559.0097159IPR003441NAC domain
PfamPF023657.1E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0008361Biological Processregulation of cell size
GO:0009416Biological Processresponse to light stimulus
GO:0009611Biological Processresponse to wounding
GO:0009620Biological Processresponse to fungus
GO:0009744Biological Processresponse to sucrose
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0043424Molecular Functionprotein histidine kinase binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0003018anatomyroot cap of lateral root
PO:0006340anatomyadult vascular leaf
PO:0020030anatomycotyledon
PO:0020121anatomylateral root
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MKSELNLPAG FRFHPTDEEL VKFYLCRKCA SEQISAPVIA EIDLYKFNPW ELPEMSLYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGKP KTLGIKKALV FYAGKAPKGI  120
KTNWIMHEYR LANVDRSASV NKKNNLRLDD WVLCRIYNKK GTMEKYFPAD EKPRTTTMAE  180
QSSSPFDTSD STYPTLQEDD SSSSGGHGHV VSPDVLEVQS EPKWGELEDA LEAFDTSMFG  240
SSMELLQPDA FVPQFLYQSD YFTSFQDPPE QKPFLNWSFA PQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-84216510174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.278260.0flower| inflorescence| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G08790
AtGenExpressAT5G08790
Functional Description ? help Back to Top
Source Description
TAIRinduced by wounding, belongs to a large family of putative transcriptional activators with NAC domain.
Function -- GeneRIF ? help Back to Top
  1. ATAF2 overexpressing plants showed a higher susceptibility to the soil-borne fungal pathogen F.oxysporum, and repression of a number of pathogenesis-related proteins.
    [PMID: 16115070]
  2. The identification of a cis-regulatory binding sequence for ATAF2, is reported.
    [PMID: 22937923]
  3. ATAF2 regulates NIT2 gene expression via NIT2 promoter binding.
    [PMID: 22965747]
  4. ATAF2 acts as a central regulator of plant defense, hormone metabolism and light-mediated seedling development
    [PMID: 26493403]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G08790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G08790
IntActSearch Q9C598
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G08790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1337620.0AY133762.1 Arabidopsis thaliana clone U18877 unknown protein (At5g08980) mRNA, complete cds.
GenBankAY0808620.0AY080862.1 Arabidopsis thaliana unknown protein (At5g08790) mRNA, complete cds.
GenBankAK2288030.0AK228803.1 Arabidopsis thaliana mRNA for ATAF2 protein, complete cds, clone: RAFL16-12-H06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_680161.10.0protein ATAF2
SwissprotQ9C5980.0NAC81_ARATH; Protein ATAF2
TrEMBLD7M2080.0D7M208_ARALL; Putative uncharacterized protein
STRINGAT5G08790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MalvidsOGEM19028276
Publications ? help Back to Top
  1. Collinge M,Boller T
    Differential induction of two potato genes, Stprx2 and StNAC, in response to infection by Phytophthora infestans and to wounding.
    Plant Mol. Biol., 2001. 46(5): p. 521-9
    [PMID:11516145]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Mart
    Genomic analysis of the unfolded protein response in Arabidopsis shows its connection to important cellular processes.
    Plant Cell, 2003. 15(2): p. 561-76
    [PMID:12566592]
  4. Greve K,La Cour T,Jensen MK,Poulsen FM,Skriver K
    Interactions between plant RING-H2 and plant-specific NAC (NAM/ATAF1/2/CUC2) proteins: RING-H2 molecular specificity and cellular localization.
    Biochem. J., 2003. 371(Pt 1): p. 97-108
    [PMID:12646039]
  5. Hammond JP, et al.
    Changes in gene expression in Arabidopsis shoots during phosphate starvation and the potential for developing smart plants.
    Plant Physiol., 2003. 132(2): p. 578-96
    [PMID:12805589]
  6. Ekman DR,Lorenz WW,Przybyla AE,Wolfe NL,Dean JF
    SAGE analysis of transcriptome responses in Arabidopsis roots exposed to 2,4,6-trinitrotoluene.
    Plant Physiol., 2003. 133(3): p. 1397-406
    [PMID:14551330]
  7. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  8. Hegedus D, et al.
    Molecular characterization of Brassica napus NAC domain transcriptional activators induced in response to biotic and abiotic stress.
    Plant Mol. Biol., 2003. 53(3): p. 383-97
    [PMID:14750526]
  9. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  10. Ernst HA,Olsen AN,Larsen S,Lo Leggio L
    Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.
    EMBO Rep., 2004. 5(3): p. 297-303
    [PMID:15083810]
  11. Delessert C, et al.
    The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.
    Plant J., 2005. 43(5): p. 745-57
    [PMID:16115070]
  12. Nakano T, et al.
    Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana.
    J. Plant Res., 2006. 119(4): p. 407-13
    [PMID:16820983]
  13. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  14. Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM
    Light has a specific role in modulating Arabidopsis gene expression at low temperature.
    BMC Plant Biol., 2008. 8: p. 13
    [PMID:18230142]
  15. Dortay H, et al.
    Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.
    J. Proteome Res., 2008. 7(9): p. 3649-60
    [PMID:18642946]
  16. Abercrombie JM, et al.
    Transcriptional responses of Arabidopsis thaliana plants to As (V) stress.
    BMC Plant Biol., 2008. 8: p. 87
    [PMID:18684332]
  17. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  18. Wang X,Goregaoker SP,Culver JN
    Interaction of the Tobacco mosaic virus replicase protein with a NAC domain transcription factor is associated with the suppression of systemic host defenses.
    J. Virol., 2009. 83(19): p. 9720-30
    [PMID:19625399]
  19. Miller MJ,Barrett-Wilt GA,Hua Z,Vierstra RD
    Proteomic analyses identify a diverse array of nuclear processes affected by small ubiquitin-like modifier conjugation in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(38): p. 16512-7
    [PMID:20813957]
  20. Wang X,Culver JN
    DNA binding specificity of ATAF2, a NAC domain transcription factor targeted for degradation by Tobacco mosaic virus.
    BMC Plant Biol., 2012. 12: p. 157
    [PMID:22937923]
  21. Huh SU,Lee SB,Kim HH,Paek KH
    ATAF2, a NAC transcription factor, binds to the promoter and regulates NIT2 gene expression involved in auxin biosynthesis.
    Mol. Cells, 2012. 34(3): p. 305-13
    [PMID:22965747]
  22. Zhao J,Favero DS,Peng H,Neff MM
    Arabidopsis thaliana AHL family modulates hypocotyl growth redundantly by interacting with each other via the PPC/DUF296 domain.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. E4688-97
    [PMID:24218605]
  23. Peng H,Zhao J,Neff MM
    ATAF2 integrates Arabidopsis brassinosteroid inactivation and seedling photomorphogenesis.
    Development, 2015. 142(23): p. 4129-38
    [PMID:26493403]