PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G08520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 298aa    MW: 31814 Da    PI: 6.8042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G08520.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.7e-091155345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      W+ e+d  + +a +    +   +W++Ia+ ++ g++ +q+k+++ 
      AT5G08520.1 11 VWSREDDIAFERALANNTDEseeRWEKIAADVP-GKSVEQIKEHYE 55
                     6*****************99*************.**********95 PP

2Myb_DNA-binding422.2e-13119163347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
      AT5G08520.1 119 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 163
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.16762IPR017884SANT domain
SMARTSM007177.1E-8860IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-91066IPR009057Homeodomain-like
PfamPF002491.1E-71155IPR001005SANT/Myb domain
CDDcd001679.80E-81258No hitNo description
Gene3DG3DSA:1.10.10.602.3E-41254IPR009057Homeodomain-like
PROSITE profilePS5129417.581111168IPR017930Myb domain
SuperFamilySSF466891.22E-16114169IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17116166IPR006447Myb domain, plants
SMARTSM007173.2E-10116166IPR001005SANT/Myb domain
CDDcd001678.62E-10119164No hitNo description
PfamPF002492.7E-11119163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-10119162IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MTVEEVSDGS VWSREDDIAF ERALANNTDE SEERWEKIAA DVPGKSVEQI KEHYELLVED  60
VTRIESGCVP LPAYGSPEGS NGHAGDEGAS SKKGGNSHAG ESNQAGKSKS DQERRKGIAW  120
TEDEHRLFLL GLDKYGKGDW RSISRNFVVT RTPTQVASHA QKYFIRLNSM NKDRRRSSIH  180
DITSVGNADV STPQGPITGQ NNSNNNNNNN NNNSSPAVAG GGNKSAKQAV SQAPPGPPMY  240
GTPAIGQPAV GTPVNLPAPP HMAYGVHAAP VPGSVVPGAA MNIGQMPYTM PRTPTAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-14979878RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.87620.0bud| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453577920.0
Genevisible250524_at0.0
Expression AtlasAT5G08520-
AtGenExpressAT5G08520-
ATTED-IIAT5G08520-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Function -- GeneRIF ? help Back to Top
  1. At5g08520 is an important transcriptional regulator that directly targets abscisic acid biosynthesis and signaling-related genes and therefore may be regarded as an important regulator of abscisic acid -mediated salt stress tolerance.
    [PMID: 26243618]
  2. Results indicate that MYBS1 and MYBS2 play opposite roles in regulating glucose and abscissic acid signaling in Arabidopsis during seed germination and early seedling development.[MYBS2]
    [PMID: 27866313]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G08520.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G08520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0720900.0AY072090.1 Arabidopsis thaliana unknown protein (At5g08520) mRNA, complete cds.
GenBankAY0965710.0AY096571.1 Arabidopsis thaliana unknown protein (At5g08520) mRNA, complete cds.
GenBankAY5195320.0AY519532.1 Arabidopsis thaliana MYB transcription factor (At5g08520) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196469.10.0Duplicated homeodomain-like superfamily protein
SwissprotQ9FNN60.0SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A178UB140.0A0A178UB14_ARATH; Uncharacterized protein
STRINGAT5G08520.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Representative plantOGRP27517122
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  3. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  4. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  5. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]