PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G08141.1
Common NameAtbZIP75, bZIP75, T22D6_80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 137aa    MW: 16537.2 Da    PI: 6.4163
Description basic leucine-zipper 75
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G08141.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.41.5e-083578346
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46
                 e kr rr+++NRe+Arr R R ++  e L+  vk+L a N+ L 
  AT5G08141.1 35 EEKRLRRMASNRESARRTRMRERMMKEGLQMQVKQLMAYNQFLY 78
                 569************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.3E-93091No hitNo description
PfamPF077165.0E-133384IPR004827Basic-leucine zipper domain
SMARTSM003385.1E-63397IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.3933598IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.06E-83791No hitNo description
PROSITE patternPS0003604055IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MFQQNLHDED DVHVQDHVYN HDQYHHQQPN VVTDEEKRLR RMASNRESAR RTRMRERMMK  60
EGLQMQVKQL MAYNQFLYNK YISLLEYNHQ ILQENSQLKE TVSSFHDQYT ISYGNHEGIL  120
GNTNDFDLNQ LSSYQPS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306822540.0
Expression AtlasAT5G08141-
AtGenExpressAT5G08141-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G08141.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9LEZ2
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G08141
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankAL3576120.0AL357612.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T22D6 (ESSA project).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850791.14e-98basic leucine-zipper 75
TrEMBLF4K9L75e-98F4K9L7_ARATH; Basic leucine-zipper 75
TrEMBLQ9LEZ23e-94Q9LEZ2_ARATH; Putative uncharacterized protein T22D6_80
STRINGAT5G08141.11e-97(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17031811
Publications ? help Back to Top
  1. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  2. Ehlert A, et al.
    Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
    Plant J., 2006. 46(5): p. 890-900
    [PMID:16709202]
  3. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]