PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G08070.1
Common NameT22D6.10, TCP17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TCP
Protein Properties Length: 242aa    MW: 27411.8 Da    PI: 9.3594
Description TCP domain protein 17
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G08070.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP92.31e-283199270
          TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                  g+kdrhsk++T +g+RdRR+Rls+ +a++++dLq++LG+ ++sk i+WLl+ ak  ++ l+ +++++ 
  AT5G08070.1 31 FGGKDRHSKVCTVRGLRDRRIRLSVMTAIQVYDLQERLGLSQPSKVIDWLLEVAKNDVDLLPPLQFPPG 99
                 689***********************************************************9977776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.313391IPR017887Transcription factor TCP subgroup
PfamPF036346.6E-2733132IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000056anatomyflower bud
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGIKKEDQKS SLSLLTQRWN NPRIVRVSRA FGGKDRHSKV CTVRGLRDRR IRLSVMTAIQ  60
VYDLQERLGL SQPSKVIDWL LEVAKNDVDL LPPLQFPPGF HQLNPNLTGL GESFPGVFDL  120
GRTQREALDL EKRKWVNLDH VFDHIDHHNH FSNSIQSNKL YFPTITSSSS SYHYNLGHLQ  180
QSLLDQSGNV TVAFSNNYNN NNLNPPAAET MSSLFPTRYP SFLGGGQLQL FSSTSSQPDH  240
IE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-173892155Putative transcription factor PCF6
5zkt_B3e-173892155Putative transcription factor PCF6
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250566_at0.0
Expression AtlasAT5G08070-
AtGenExpressAT5G08070-
ATTED-IIAT5G08070-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}.
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, roots, stems, buds, flowers and siliques. {ECO:0000269|PubMed:17307931}.
Functional Description ? help Back to Top
Source Description
TAIRTCP gene involved in heterochronic control of leaf differentiation.
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00497DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G08070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G08330, AT5G51910, AT5G60970, AT1G30210, AT1G35560, AT1G53230, AT1G58100, AT1G69690
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G08070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL3576120.0AL357612.1 Arabidopsis thaliana DNA chromosome 5, BAC clone T22D6 (ESSA project).
GenBankBT0299950.0BT029995.1 Arabidopsis thaliana At5g08070 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001318505.11e-179TCP domain protein 17
RefseqNP_196424.11e-179TCP domain protein 17
SwissprotQ9LEZ91e-180TCP17_ARATH; Transcription factor TCP17
TrEMBLA0A178UHH91e-178A0A178UHH9_ARATH; TCP17
STRINGAT5G08070.11e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35762763
Representative plantOGRP18015163
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. Qin G, et al.
    An indole-3-acetic acid carboxyl methyltransferase regulates Arabidopsis leaf development.
    Plant Cell, 2005. 17(10): p. 2693-704
    [PMID:16169896]
  4. Damerval C,Le Guilloux M,Jager M,Charon C
    Diversity and evolution of CYCLOIDEA-like TCP genes in relation to flower development in Papaveraceae.
    Plant Physiol., 2007. 143(2): p. 759-72
    [PMID:17189327]
  5. Aguilar-Martínez JA,Poza-Carrión C,Cubas P
    Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds.
    Plant Cell, 2007. 19(2): p. 458-72
    [PMID:17307924]
  6. Koyama T,Furutani M,Tasaka M,Ohme-Takagi M
    TCP transcription factors control the morphology of shoot lateral organs via negative regulation of the expression of boundary-specific genes in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 473-84
    [PMID:17307931]
  7. Efroni I,Blum E,Goldshmidt A,Eshed Y
    A protracted and dynamic maturation schedule underlies Arabidopsis leaf development.
    Plant Cell, 2008. 20(9): p. 2293-306
    [PMID:18805992]
  8. Danisman S, et al.
    Analysis of functional redundancies within the Arabidopsis TCP transcription factor family.
    J. Exp. Bot., 2013. 64(18): p. 5673-85
    [PMID:24129704]
  9. Wei B, et al.
    The molecular mechanism of sporocyteless/nozzle in controlling Arabidopsis ovule development.
    Cell Res., 2015. 25(1): p. 121-34
    [PMID:25378179]
  10. Chen GH,Sun JY,Liu M,Liu J,Yang WC
    SPOROCYTELESS is a novel embryophyte-specific transcription repressor that interacts with TPL and TCP proteins in Arabidopsis.
    J Genet Genomics, 2014. 41(12): p. 617-25
    [PMID:25527103]
  11. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]