PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G07680.1
Common NameANAC079, ANAC080, ATNAC4, MBK20.13, NAC079, NAC080, NAC4, TGT2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 329aa    MW: 37517.5 Da    PI: 9.178
Description NAC domain containing protein 80
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G07680.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.16.9e-57171421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL+kkv +  +++ ++i evd++k+ePw+Lp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++
  AT5G07680.1  17 LPPGFRFHPTDEELITHYLHKKVLDLGFSA-KAIGEVDLNKAEPWELPYKAKIGEKEWYFFCVRDRKYPTGLRTNRATQAGYWKATGKDKEIFR-GKS 112
                  79***************************9.89***************99999*****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg+kktLvfy+grapkg+kt+Wvmheyrl
  AT5G07680.1 113 LVGMKKTLVFYRGRAPKGQKTNWVMHEYRL 142
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-6513167IPR003441NAC domain
PROSITE profilePS5100560.07117167IPR003441NAC domain
PfamPF023657.5E-3018142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
METFGVFHKE DDEQMDLPPG FRFHPTDEEL ITHYLHKKVL DLGFSAKAIG EVDLNKAEPW  60
ELPYKAKIGE KEWYFFCVRD RKYPTGLRTN RATQAGYWKA TGKDKEIFRG KSLVGMKKTL  120
VFYRGRAPKG QKTNWVMHEY RLDGKLSAHN LPKTAKNEWV ICRVFHKTAG GKKIPISTLI  180
RIGSYGTGSS LPPLTDSSPY NDKTKTEPVY VPCFSNQAET RGTILNCFSN PSLSSIQPDF  240
LQMIPLYQPQ SLNISESSNP VLTQEQSVLQ AMMENNRRQN FKTLSISQET GVSNTDNSSV  300
FEFGRKRFDH QEVPSPSSGP VDLEPFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-5641737174NAC domain-containing protein 19
3swp_C3e-5641737174NAC domain-containing protein 19
3swp_B3e-5641737174NAC domain-containing protein 19
3swp_A3e-5641737174NAC domain-containing protein 19
3swm_D3e-5641737174NAC domain-containing protein 19
3swm_C3e-5641737174NAC domain-containing protein 19
3swm_B3e-5641737174NAC domain-containing protein 19
3swm_A3e-5641737174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.326890.0flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible250597_at0.0
Expression AtlasAT5G07680-
AtGenExpressAT5G07680-
ATTED-IIAT5G07680-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at low levels in leaves. {ECO:0000269|PubMed:17098808}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G07680.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G07680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0064190.0BT006419.1 Arabidopsis thaliana At5g07680 gene, complete cds.
GenBankAK2280270.0AK228027.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, complete cds, clone: RAFL14-54-D06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568182.20.0NAC domain containing protein 80
SwissprotQ9FLR30.0NAC79_ARATH; NAC domain-containing protein 79
TrEMBLD7M0L40.0D7M0L4_ARALL; ANAC079/ANAC080/ATNAC4
STRINGAT5G07680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  3. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  4. Laufs P,Peaucelle A,Morin H,Traas J
    MicroRNA regulation of the CUC genes is required for boundary size control in Arabidopsis meristems.
    Development, 2004. 131(17): p. 4311-22
    [PMID:15294871]
  5. Baker CC,Sieber P,Wellmer F,Meyerowitz EM
    The early extra petals1 mutant uncovers a role for microRNA miR164c in regulating petal number in Arabidopsis.
    Curr. Biol., 2005. 15(4): p. 303-15
    [PMID:15723790]
  6. Guo HS,Xie Q,Fei JF,Chua NH
    MicroRNA directs mRNA cleavage of the transcription factor NAC1 to downregulate auxin signals for arabidopsis lateral root development.
    Plant Cell, 2005. 17(5): p. 1376-86
    [PMID:15829603]
  7. Alvarez JP, et al.
    Endogenous and synthetic microRNAs stimulate simultaneous, efficient, and localized regulation of multiple targets in diverse species.
    Plant Cell, 2006. 18(5): p. 1134-51
    [PMID:16603651]
  8. Nikovics K, et al.
    The balance between the MIR164A and CUC2 genes controls leaf margin serration in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2929-45
    [PMID:17098808]
  9. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  10. Ehrenreich IM,Purugganan MD
    Sequence variation of MicroRNAs and their binding sites in Arabidopsis.
    Plant Physiol., 2008. 146(4): p. 1974-82
    [PMID:18305205]
  11. Raman S, et al.
    Interplay of miR164, CUP-SHAPED COTYLEDON genes and LATERAL SUPPRESSOR controls axillary meristem formation in Arabidopsis thaliana.
    Plant J., 2008. 55(1): p. 65-76
    [PMID:18346190]
  12. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  13. Vidal EA,Moyano TC,Riveras E,Contreras-L
    Systems approaches map regulatory networks downstream of the auxin receptor AFB3 in the nitrate response of Arabidopsis thaliana roots.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(31): p. 12840-5
    [PMID:23847199]
  14. Pei H, et al.
    An NAC transcription factor controls ethylene-regulated cell expansion in flower petals.
    Plant Physiol., 2013. 163(2): p. 775-91
    [PMID:23933991]